Notch-3 Antibody (1G5)

ELISA: Notch-3 Antibody (1G5) [H00004854-M01] - Detection limit for recombinant GST tagged NOTCH3 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA
• Clone: 1G5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

Notch-3 Antibody (1G5) Summary

• Immunogen: NOTCH3 (NP_000426, 47 a.a. ~ 156 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCR
• Specificity: NOTCH3 - Notch homolog 3 (Drosophila)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NOTCH3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA 1:100-1:2000
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
• Control:

  Notch-3 Knockout 293T Cell Lysate

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Notch-3 Antibody (1G5)

• CADASIL
• CASILneurogenic locus notch homolog protein 3
• Notch (Drosophila) homolog 3
• notch 3Notch homolog 3 (Drosophila)
• Notch homolog 3
• Notch3
• Notch-3

Background

This gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remains to be determined. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Notch-3 Antibody (H00004854-M01)(9)

Publications using H00004854-M01

• Nagatoshi A, Ueda M, Ueda A et al. Serum amyloid P component: A novel potential player in vessel degeneration in CADASIL. J Neurol Sci 2017 May 26 [PMID: 28716282]
• Zhang X, Wang YN, Zhu JJ et al. N-acetylcysteine negatively regulates Notch3 and its malignant signaling. Oncotarget. May 24 2016 [PMID: 27102435] (WB, Human)
• Meng H, Zhang X, Lee SJ, Wang MM. Von Willebrand Factor Inhibits Mature Smooth Muscle Gene Expression through Impairment of Notch Signaling. PLoS One. 2013 Sep 23 [PMID: 24086636]
• Dong H, Blaivas M, Wang MM. Bidirectional encroachment of collagen into the tunica media in cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Brain Res. 2012 Mar 23 [PMID: 22503071]
• Tada M, Itoh S, Ishii-Watabe A et al. Functional analysis of the Notch ligand Jagged1 missense mutant proteins underlying Alagille syndrome. FEBS J. 2012 Apr 06 [PMID: 22487239]
• Lee SJ, Meng H, Elmadhoun O et al. Cerebral Autosomal Dominant Arteriopathy With Subcortical Infarcts and Leukoencephalopathy Affecting an African American Man: Identification of a Novel 15-Base Pair NOTCH3 Duplication. Arch Neurol. 2011 Dec 01 [PMID: 22159056]
• Watanabe-Hosomi A, Watanabe Y, Tanaka M et al. Transendocytosis is impaired in CADASIL-mutant NOTCH3. Exp Neurol. 2011 Oct 28 [PMID: 22079830]
• Meng H, Zhang X, Hankenson KD et al. Thrombospondin2 potentiates notch3/Jagged1 signaling. J Biol Chem 284(12):7866-74. 2009 Mar 20. [PMID: 19147503]
• Park JT, Shih IeM, Wang TL. Identification of Pbx1, a Potential Oncogene, as a Notch3 Target Gene in Ovarian Cancer. Cancer Res. 2008 Nov 01 [PMID: 18974129]

Review for Notch-3 Antibody (H00004854-M01) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Rat.

reviewed by: Anonymous WB Rat 05/26/2009

Summary

• Application: Western Blot
• Sample Tested: A7R5 cells
• Species: Rat
• Lot: 08235-1G5

Blocking

• Blocking Details: Blocking Buffer: 5% milk in TBST, Blocking Time: 1 hour, Blocking Temp: 25 degrees Celsius

Primary Anitbody

• Dilution Ratio: Primary Ab Dilution Ratio: 1/5000, Primary Ab Incubation Time: 2 hours, Primary Ab Incubation Temp: 25 degrees Celsius

Secondary Antibody

• Secondary Description: Secondary Ab: ALEXA FLUOR 680 GOAT ANTI MOUSE, Secondary Ab Dilution Ratio: 1/10000

Details

• Detection Notes: Detection Method: Odyssey, Exposure Time: 30 minutes, Specific Bands: over 250 kDa and about 210 kDa

Bioinformatics

• Gene Symbol: NOTCH3
• Entrez:
  • 4854(Human)
• Uniprot:
  • NP_000426(Human)