Notch-3 Antibody (1G5)

ELISA: Notch-3 Antibody (1G5) [H00004854-M01] - Detection limit for recombinant GST tagged NOTCH3 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 1G5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

Notch-3 Antibody (1G5) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: NOTCH3 (NP_000426, 47 a.a. ~ 156 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCR
• Specificity: NOTCH3 - Notch homolog 3 (Drosophila)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NOTCH3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Notch-3 Antibody (1G5)

• CADASIL
• CASILneurogenic locus notch homolog protein 3
• Notch (Drosophila) homolog 3
• notch 3Notch homolog 3 (Drosophila)
• Notch homolog 3
• Notch3
• Notch-3

Background

This gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remains to be determined. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Notch-3 Antibody (H00004854-M01)(13)

Publications using H00004854-M01

• SJ Lee, X Zhang, G Xu, J Borjigin, MM Wang A mid-position NOTCH3 truncation in inherited cerebral small vessel disease may affect the protein interactome The Journal of Biological Chemistry, 2022-12-05;0(0):102772. 2022-12-05 [PMID: 36470429]
• Kenneth G, Yijie G, Andreas G et al. NOTCH3-targeted antibody drug conjugates regress tumors by inducing apoptosis in receptor cells and through transendocytosis into ligand cells. Cell Rep Med. 2021-05-18 [PMID: 34095881]
• Shodai S, Satoshi H, Taiki M et al. Lunatic fringe promotes the aggregation of CADASIL NOTCH3 mutant proteins. Biochem Biophys Res Commun. 2021-04-21 [PMID: 33894418]
• Shin K, Cha Y, Ban Y et al. Anti-osteoarthritis effect of a combination treatment with human adipose tissue-derived mesenchymal stem cells and thrombospondin 2 in rabbits. World J Stem Cells. 2019-12-26 [PMID: 31875872]
• Nagatoshi A, Ueda M, Ueda A et al. Serum amyloid P component: A novel potential player in vessel degeneration in CADASIL. J Neurol Sci 2017-05-26 [PMID: 28716282]
• Zhang X, Wang YN, Zhu JJ et al. N-acetylcysteine negatively regulates Notch3 and its malignant signaling. Oncotarget. 2016-05-24 [PMID: 27102435] (WB, Human)
• Meng H, Zhang X, Lee SJ, Wang MM. Von Willebrand Factor Inhibits Mature Smooth Muscle Gene Expression through Impairment of Notch Signaling. PLoS One. 2013-09-23 [PMID: 24086636]
• Dong H, Blaivas M, Wang MM. Bidirectional encroachment of collagen into the tunica media in cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Brain Res. 2012-03-23 [PMID: 22503071]
• Tada M, Itoh S, Ishii-Watabe A et al. Functional analysis of the Notch ligand Jagged1 missense mutant proteins underlying Alagille syndrome. FEBS J. 2012-04-06 [PMID: 22487239]
• Lee SJ, Meng H, Elmadhoun O et al. Cerebral Autosomal Dominant Arteriopathy With Subcortical Infarcts and Leukoencephalopathy Affecting an African American Man: Identification of a Novel 15-Base Pair NOTCH3 Duplication. Arch Neurol. 2011-12-01 [PMID: 22159056]
• Watanabe-Hosomi A, Watanabe Y, Tanaka M et al. Transendocytosis is impaired in CADASIL-mutant NOTCH3. Exp Neurol. 2011-10-28 [PMID: 22079830]
• Meng H, Zhang X, Hankenson KD et al. Thrombospondin2 potentiates notch3/Jagged1 signaling. J Biol Chem 284(12):7866-74. 2009-03-20 [PMID: 19147503]
• Park JT, Shih IeM, Wang TL. Identification of Pbx1, a Potential Oncogene, as a Notch3 Target Gene in Ovarian Cancer. Cancer Res. 2008-11-01 [PMID: 18974129]

Review for Notch-3 Antibody (H00004854-M01) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Rat.

reviewed by: Verified Customer WB Rat 05/26/2009

Summary

• Application: Western Blot
• Sample Tested: A7R5 cells
• Species: Rat
• Lot: 08235-1G5

Bioinformatics

• Gene Symbol: NOTCH3
• Entrez:
  • 4854(Human)
• Uniprot:
  • NP_000426(Human)