Notch-3 Antibody (1G5)

Images

 
ELISA: Notch-3 Antibody (1G5) [H00004854-M01] - Detection limit for recombinant GST tagged NOTCH3 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1G5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Notch-3 Antibody (1G5) Summary

Immunogen
NOTCH3 (NP_000426, 47 a.a. - 156 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCR
Specificity
NOTCH3 - Notch homolog 3 (Drosophila)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NOTCH3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Control
Notch-3 Lysate (NBP2-66085)
Reviewed Applications
Read 1 Review rated 5
using
H00004854-M01 in the following applications:

Publications
Read Publications using
H00004854-M01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Notch-3 Antibody (1G5)

  • CADASIL
  • CASILneurogenic locus notch homolog protein 3
  • Notch (Drosophila) homolog 3
  • notch 3Notch homolog 3 (Drosophila)
  • Notch homolog 3
  • Notch3
  • Notch-3

Background

This gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remains to be determined. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
NBP2-27347
Species: Hu
Applications: WB
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-33427
Species: Hu
Applications: WB, ICC/IF, ChIP
NBP1-86337
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P
NB600-892
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-27152
Species: Mu
Applications: WB
NBP2-57809
Species: Hu
Applications: ICC/IF
NBP2-41305
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-23869
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF
H00004854-M01
Species: Hu
Applications: WB, ELISA

Publications for Notch-3 Antibody (H00004854-M01)(9)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 9 of 9.
Publications using H00004854-M01 Applications Species
Nagatoshi A, Ueda M, Ueda A et al. Serum amyloid P component: A novel potential player in vessel degeneration in CADASIL. J Neurol Sci 2017 May 26 [PMID: 28716282]
Zhang X, Wang YN, Zhu JJ et al. N-acetylcysteine negatively regulates Notch3 and its malignant signaling. Oncotarget. May 24 2016 [PMID: 27102435] (WB, Human) WB Human
Meng H, Zhang X, Lee SJ, Wang MM. Von Willebrand Factor Inhibits Mature Smooth Muscle Gene Expression through Impairment of Notch Signaling. PLoS One. 2013 Sep 23 [PMID: 24086636]
Dong H, Blaivas M, Wang MM. Bidirectional encroachment of collagen into the tunica media in cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Brain Res. 2012 Mar 23 [PMID: 22503071]
Tada M, Itoh S, Ishii-Watabe A et al. Functional analysis of the Notch ligand Jagged1 missense mutant proteins underlying Alagille syndrome. FEBS J. 2012 Apr 06 [PMID: 22487239]
Lee SJ, Meng H, Elmadhoun O et al. Cerebral Autosomal Dominant Arteriopathy With Subcortical Infarcts and Leukoencephalopathy Affecting an African American Man: Identification of a Novel 15-Base Pair NOTCH3 Duplication. Arch Neurol. 2011 Dec 01 [PMID: 22159056]
Watanabe-Hosomi A, Watanabe Y, Tanaka M et al. Transendocytosis is impaired in CADASIL-mutant NOTCH3. Exp Neurol. 2011 Oct 28 [PMID: 22079830]
Meng H, Zhang X, Hankenson KD et al. Thrombospondin2 potentiates notch3/Jagged1 signaling. J Biol Chem 284(12):7866-74. 2009 Mar 20. [PMID: 19147503]
Park JT, Shih IeM, Wang TL. Identification of Pbx1, a Potential Oncogene, as a Notch3 Target Gene in Ovarian Cancer. Cancer Res. 2008 Nov 01 [PMID: 18974129]

Review for Notch-3 Antibody (H00004854-M01) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using H00004854-M01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Anonymous
WB Rat 05/26/2009
View

Summary

ApplicationWestern Blot
Sample TestedA7R5 cells
SpeciesRat
Lot08235-1G5

Blocking

Blocking DetailsBlocking Buffer: 5% milk in TBST, Blocking Time: 1 hour, Blocking Temp: 25 degrees Celsius

Primary Anitbody

Dilution RatioPrimary Ab Dilution Ratio: 1/5000, Primary Ab Incubation Time: 2 hours, Primary Ab Incubation Temp: 25 degrees Celsius

Secondary Antibody

Secondary DescriptionSecondary Ab: ALEXA FLUOR 680 GOAT ANTI MOUSE, Secondary Ab Dilution Ratio: 1/10000

Details

Detection NotesDetection Method: Odyssey, Exposure Time: 30 minutes, Specific Bands: over 250 kDa and about 210 kDa

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Notch-3 Antibody (H00004854-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Notch-3 Antibody (H00004854-M01)

Discover related pathways, diseases and genes to Notch-3 Antibody (H00004854-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Notch-3 Antibody (H00004854-M01)

Discover more about diseases related to Notch-3 Antibody (H00004854-M01).
 

Pathways for Notch-3 Antibody (H00004854-M01)

View related products by pathway.

PTMs for Notch-3 Antibody (H00004854-M01)

Learn more about PTMs related to Notch-3 Antibody (H00004854-M01).
 

Research Areas for Notch-3 Antibody (H00004854-M01)

Find related products by research area.

Blogs on Notch-3

There are no specific blogs for Notch-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

 
Anonymous
05/26/2009
Application: WB
Species: Rat

Bioinformatics

Gene Symbol NOTCH3
Entrez
Uniprot