Home » Notch-3 » Notch-3 Antibodies » Notch-3 Antibody (1G5)

Notch-3 Antibody (1G5)

 (9 Publications)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
ELISA: Notch-3 Antibody (1G5) [H00004854-M01] - Detection limit for recombinant GST tagged NOTCH3 is approximately 0.03ng/ml as a capture antibody.
ELISA: Notch-3 Antibody (1G5) [H00004854-M01] - Detection limit for recombinant GST tagged NOTCH3 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1G5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Notch-3 Antibody (1G5) Summary

Immunogen
NOTCH3 (NP_000426, 47 a.a. - 156 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCR
Specificity
NOTCH3 - Notch homolog 3 (Drosophila)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NOTCH3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Positive Control
Notch-3 Lysate (NBP2-66085)
Reviewed Applications
Read 1 Review rated 5
using
H00004854-M01 in the following applications:
Publications
Read Publications using
H00004854-M01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Notch-3 Antibody (1G5)

  • CADASIL
  • CASILneurogenic locus notch homolog protein 3
  • Notch (Drosophila) homolog 3
  • notch 3Notch homolog 3 (Drosophila)
  • Notch homolog 3
  • Notch3
  • Notch-3

Background

This gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remains to be determined. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Notch-1 Antibody
(mN1A)
NB100-78486
Knockout Validated: Notch-1 Antibody (mN1A) [NB100-78486] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Notch-1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2.0 ug/mL of Mouse Anti-Human Notch-1 Monoclonal Antibody (Catalog # NB100-78486) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for Notch-1 at approximately 110 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Notch-1 Antibody (mN1A) [NB100-78486] - Cell extracts from Jurkat (Lane 1) or mouse thymocytes (Lane 2) were Western Blot analyzed with monoclonal anti-NOTCH1 antibody. The mN1A antibody recognizes both mouse and human 270 kD full-length NOTCH1 and 110-120 kD cleaved NOTCH 1 (NICD).
Immunocytochemistry/Immunofluorescence: Notch-1 Antibody (mN1A) [NB100-78486] - The Notch1 Antibody was tested in HEK293 cells at a 1:50 dilution against Dylight 488 (Green). Actin was counterstained against Phalloidin 568 (Red) and cells were mounted in DAPI Flouromount (Blue).
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
Notch-2 Antibody
AF1190
Notch‑2 was detected in perfusion fixed frozen sections of rat brain (choroid plexus) using 5 µg/mL Goat Anti-Rat Notch‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1190) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Notch‑2 was detected in immersion fixed frozen sections of embryonic rat liver (15 d.p.c.) using 1.7 µg/mL Goat Anti-Rat Notch‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1190) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
Notch-4 Antibody
NB100-93551
Western Blot: Notch-4 Antibody [NB100-93551] - Analysis of Notch-4 in 1. Jurkat 2. U937 3. WEHI 4. Raw267 cell lysates.
Immunocytochemistry/Immunofluorescence: Notch-4 Antibody [NB100-93551] - Notch-4 antibody (1:500) was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 20x.
Immunohistochemistry-Paraffin: Notch-4 Antibody [NB100-93551] - Analysis of Notch-4 in human intestine.
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Aurora A Antibody
NBP1-51843
Western Blot: Aurora A Antibody [NBP1-51843] - WB detection of Aurora A in HeLa whole cell lysate.
Immunocytochemistry/Immunofluorescence: Aurora A Antibody [NBP1-51843] - IF Confocal analysis of HeLa cells using Aurora A antibody (NBP1-51843, 1:10). An Alexa Fluor 488-conjugated Goat to rabbit IgG was used as secondary antibody (green). Actin filaments were labeled with Alexa Fluor 568 phalloidin (red). DAPI was used to stain the cell nuclei (blue).
Immunohistochemistry: Aurora A Antibody [NBP1-51843] - IHC staining of Aurora A in mouse brain.
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
HES-1 Antibody
(OTI4H1)
NBP1-47791
Western Blot: HES-1 Antibody (4H1) [NBP1-47791] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Hes1(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Hes1.
Immunocytochemistry/Immunofluorescence: HES-1 Antibody (4H1) [NBP1-47791] - HeLa cells using anti-HES1 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: HES-1 Antibody (4H1) [NBP1-47791] - Staining of paraffin-embedded liver using anti-Hes1 mouse monoclonal antibody.
(5 Publications)
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
C21orf33 Antibody
(1F5)
H00008209-M01
Western Blot: C21orf33 Antibody (1F5) [H00008209-M01] - C21orf33 monoclonal antibody (M01), clone 1F5 Analysis of C21orf33 expression in HeLa.
Immunocytochemistry/Immunofluorescence: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of monoclonal antibody to C21orf33 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of monoclonal antibody to C21orf33 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
csl/RBPJK Antibody
NBP1-33427
Western Blot: csl/RBPJK Antibody [NBP1-33427] - Sample (30 ug of whole cell lysate) A: Raji 7.5% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: csl/RBPJK Antibody [NBP1-33427] - Analysis of paraformaldehyde-fixed HeLa at 1:100 dilution.
Chromatin Immunoprecipitation (ChIP): csl/RBPJK Antibody [NBP1-33427] - Sheared, cross-linked chromatin was prepared from Jurkat T-ALL cells using the Covaris TruChIP kit and shearing with the LE220 sonicator. The chromatin buffer was adjusted to 150 mM NaCl, 20 mM Tris-Cl pH 8, 2 mM EDTA, and 1% Triton X-100. Three antibodies, as well as pure pre-immune rabbit IgG control, were added to each IP reaction, consisting of 7 million cells, and incubated overnight with mixing at 4 C. The antibodies were captured with Magna ChIP Protein A+G beads (Millipore), washed with three wash buffers, and the DNA eluted and purified with the iPure v2 kit (Diagenode). The purified DNA was normalized to the input control with qPCR quantification of the insulin exon 1 gene (INS) and an RBPJ binding site in the promoter of HES1. Image from verified customer review.
(1 Review)
Species: Hu
Applications: WB, ICC/IF, ChIP
Jagged 1
[Unconjugated]
1277-JG
Jagged 1 [Unconjugated]
(1 Review)
(20 Publications)
Species: Hu
EGF [Unconjugated]
236-EG
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
(11 Reviews)
(323 Publications)
Species: Hu
Jagged 2 Antibody
NBP1-86337
Immunohistochemistry-Paraffin: Jagged 2 Antibody [NBP1-86337] - Staining of human cervix, uterine shows moderate membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Jagged 2 Antibody [NBP1-86337] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Jagged 2 Antibody [NBP1-86337] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P
DLL4 Antibody
NB600-892
Western Blot: DLL4 Antibody [NB600-892] - Shows detection of a 74-kDa band corresponding to Delta-4 in a lysate prepared from mouse pancreatic tissue. Approximately 20 ug of lysate was run on SDS-PAGE and transferred onto nitrocellulose followed by reaction with a 1:500 dilution of anti-Delta-4 antibody. Detection occurred using a 1:5,000 dilution of HRP-labeled Goat anti-Rabbit IgG for 1 hour at room temperature. A chemiluminescence system was used for signal detection (Roche) using a 3 min exposure time.
Immunohistochemistry-Paraffin: DLL4 Antibody [NB600-892] - This antibody was used at 20ug/mL in a variety of tissues including colon, liver, skeletal muscle, ovary, pancreas, prostate, testes, thymus, tonsil and uterus. In contrast to reported findings, no staining was observed in vascular tissue. This image shows Delta-4 staining of human ovary.
(13 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
HEY1 Antibody
NBP2-27152
Western Blot: HEY1 Antibody [NBP2-27152] - Analysis of Hey1 in mouse embryo brain lysate using 1) preimmune sera at 1:5000 dilution and 2) purified NBP2-27152. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Species: Mu
Applications: WB
Pref-1/DLK1/FA1
Antibody (211309)
MAB1144
Pref‑1/DLK1/FA1 was detected in immersion fixed HepG2 human hepatocellular carcinoma cell line using Mouse Anti-Human Pref‑1/DLK1/FA1 Monoclonal Antibody (Catalog # MAB1144) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell membranes. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
HepG2 human hepatocellular carcinoma cell line was stained with Mouse Anti-Human Pref‑1/DLK1/FA1 Monoclonal Antibody (Catalog # MAB1144, filled histogram) or isotype control antibody (Catalog # MAB0041, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B).
(2 Reviews)
(3 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
HEY2 Antibody
NBP2-57809
Immunocytochemistry/Immunofluorescence: HEY2 Antibody [NBP2-57809] - Staining of human cell line HEK 293 shows localization to nuclear bodies & aggresome.
Species: Hu
Applications: ICC/IF
HES5 Antibody
NBP2-41305
Western Blot: HES5 Antibody [NBP2-41305] - Western blot analysis of HES5 in Raji cell lysate with HES5 antibody at 1 ug/ml (A) the absence and (B) the presence of blocking peptide.
Immunohistochemistry: HES5 Antibody [NBP2-41305] - Staining of HES5 in mouse brain tissue with HES5 Antibodyat 5 ug/mL.
Immunohistochemistry: HES5 Antibody [NBP2-41305] - Immunohistochemistry of HES5 in human spleen tissue with HES5 antibody at 5 ug/ml.
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
HLA DQA1 Antibody
NBP1-84550
Western Blot: HLA DQA1 Antibody [NBP1-84550] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line Daudi.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human lung shows high expression.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
Species: Hu
Applications: WB, IHC, IHC-P
CTLA-4
7268-CT
CTLA-4
(2 Reviews)
(1 Publication)
Species: Hu
HTRA1/PRSS11
Antibody
NBP2-23869
Western Blot: HTRA1/PRSS11 Antibody [NBP2-23869] - Analysis of HtrA1 in human A) HeLa cell lysate (1 minute exposure) and B) human 293 cell lysate (15 minute exposure) using NBP2-23869 at 1:500.
Simple Western: HTRA1/PRSS11 Antibody [NBP2-23869] - Simple Western lane view shows a specific band for htrA1 in 0.5 mg/ml of Hek293 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(2 Publications)
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF
Notch-3 Antibody
(1G5)
H00004854-M01
Notch-3 Antibody (1G5)
Species: Hu
Applications: WB, ELISA

Publications for Notch-3 Antibody (H00004854-M01)(9)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 9 of 9.
Publications using H00004854-M01 Applications Species
Nagatoshi A, Ueda M, Ueda A et al. Serum amyloid P component: A novel potential player in vessel degeneration in CADASIL. J Neurol Sci 2017 May 26 [PMID: 28716282]
Zhang X, Wang YN, Zhu JJ et al. N-acetylcysteine negatively regulates Notch3 and its malignant signaling. Oncotarget. May 24 2016 [PMID: 27102435] (WB, Human) WB Human
Meng H, Zhang X, Lee SJ, Wang MM. Von Willebrand Factor Inhibits Mature Smooth Muscle Gene Expression through Impairment of Notch Signaling. PLoS One. 2013 Sep 23 [PMID: 24086636]
Dong H, Blaivas M, Wang MM. Bidirectional encroachment of collagen into the tunica media in cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Brain Res. 2012 Mar 23 [PMID: 22503071]
Tada M, Itoh S, Ishii-Watabe A et al. Functional analysis of the Notch ligand Jagged1 missense mutant proteins underlying Alagille syndrome. FEBS J. 2012 Apr 06 [PMID: 22487239]
Lee SJ, Meng H, Elmadhoun O et al. Cerebral Autosomal Dominant Arteriopathy With Subcortical Infarcts and Leukoencephalopathy Affecting an African American Man: Identification of a Novel 15-Base Pair NOTCH3 Duplication. Arch Neurol. 2011 Dec 01 [PMID: 22159056]
Watanabe-Hosomi A, Watanabe Y, Tanaka M et al. Transendocytosis is impaired in CADASIL-mutant NOTCH3. Exp Neurol. 2011 Oct 28 [PMID: 22079830]
Meng H, Zhang X, Hankenson KD et al. Thrombospondin2 potentiates notch3/Jagged1 signaling. J Biol Chem 284(12):7866-74. 2009 Mar 20. [PMID: 19147503]
Park JT, Shih IeM, Wang TL. Identification of Pbx1, a Potential Oncogene, as a Notch3 Target Gene in Ovarian Cancer. Cancer Res. 2008 Nov 01 [PMID: 18974129]

Review for Notch-3 Antibody (H00004854-M01) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using H00004854-M01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Anonymous
 WB Rat 05/26/2009
View

Summary

ApplicationWestern Blot
Sample TestedA7R5 cells
SpeciesRat
Lot08235-1G5

Blocking

Blocking DetailsBlocking Buffer: 5% milk in TBST, Blocking Time: 1 hour, Blocking Temp: 25 degrees Celsius

Primary Anitbody

Dilution RatioPrimary Ab Dilution Ratio: 1/5000, Primary Ab Incubation Time: 2 hours, Primary Ab Incubation Temp: 25 degrees Celsius

Secondary Antibody

Secondary DescriptionSecondary Ab: ALEXA FLUOR 680 GOAT ANTI MOUSE, Secondary Ab Dilution Ratio: 1/10000

Details

Detection NotesDetection Method: Odyssey, Exposure Time: 30 minutes, Specific Bands: over 250 kDa and about 210 kDa

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Notch-3 Antibody (H00004854-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Notch-3 Knockout 293T Cell Lysate

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Notch-3 Antibody (H00004854-M01)

Discover related pathways, diseases and genes to Notch-3 Antibody (H00004854-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Notch-3 Antibody (H00004854-M01)

Discover more about diseases related to Notch-3 Antibody (H00004854-M01).
 

Pathways for Notch-3 Antibody (H00004854-M01)

View related products by pathway.

PTMs for Notch-3 Antibody (H00004854-M01)

Learn more about PTMs related to Notch-3 Antibody (H00004854-M01).
 

Research Areas for Notch-3 Antibody (H00004854-M01)

Find related products by research area.

Blogs on Notch-3

There are no specific blogs for Notch-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
 
 Anonymous
05/26/2009
Application: WB
Species: Rat
read this review

Bioinformatics

Gene Symbol NOTCH3
Entrez
Uniprot