Home » Notch-3 » Notch-3 Antibodies » Notch-3 Antibody (1G5)

Notch-3 Antibody (1G5)

 (9 Publications)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
ELISA: Notch-3 Antibody (1G5) [H00004854-M01] - Detection limit for recombinant GST tagged NOTCH3 is approximately 0.03ng/ml as a capture antibody.
ELISA: Notch-3 Antibody (1G5) [H00004854-M01] - Detection limit for recombinant GST tagged NOTCH3 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Clone
1G5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Notch-3 Antibody (1G5) Summary

Immunogen
NOTCH3 (NP_000426, 47 a.a. ~ 156 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCR
Specificity
NOTCH3 - Notch homolog 3 (Drosophila)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NOTCH3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Reviewed Applications
Read 1 Review rated 5
using
H00004854-M01 in the following applications:
Publications
Read Publications using
H00004854-M01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Notch-3 Antibody (1G5)

  • CADASIL
  • CASILneurogenic locus notch homolog protein 3
  • Notch (Drosophila) homolog 3
  • notch 3Notch homolog 3 (Drosophila)
  • Notch homolog 3
  • Notch3
  • Notch-3

Background

This gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remains to be determined. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Notch-1 Antibody
(mN1A) - BSA Free
NB100-78486
Immunohistochemistry-Paraffin: Notch-1 Antibody (mN1A) [NB100-78486] - Analysis of FFPE human pancreatic cancer using 1:10 dilution of Notch-1 antibody on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) was performed using Aperio AT2 (Leica Biosystems). Cytoplasmic staining in epithelial cells was observed. Staining was performed by Histowiz.
Knockout Validated: Notch-1 Antibody (mN1A) [NB100-78486] - Lysates of HeLa human cervical epithelial carcinoma parental cell line and Notch-1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2.0 ug/mL of Mouse Anti-Human Notch-1 Monoclonal Antibody (Catalog # NB100-78486) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for Notch-1 at approximately 110 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Flow Cytometry: Notch-1 Antibody (mN1A) [NB100-78486] - Intracellular flow cytometric staining of 1 x 10^6 CHO (A) and MCF-7 (B) cells using Notch1 antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(2 Reviews)
(8 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Notch-2 Antibody
AF1190
Notch‑2 was detected in perfusion fixed frozen sections of rat brain (choroid plexus) using 5 µg/mL Goat Anti-Rat Notch‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1190) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Notch‑2 was detected in immersion fixed frozen sections of embryonic rat liver (15 d.p.c.) using 1.7 µg/mL Goat Anti-Rat Notch‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1190) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Species: Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
Notch-4 Antibody -
BSA Free
NB100-93551
Immunocytochemistry/Immunofluorescence: Notch-4 Antibody [NB100-93551] - Notch-4 antibody (1:500) was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 20x.
Immunohistochemistry-Paraffin: Notch-4 Antibody [NB100-93551] - Analysis of Notch-4 in human intestine.
Western Blot: Notch-4 Antibody [NB100-93551] - Analysis of Notch-4 in 1. Jurkat 2. U937 3. WEHI 4. Raw267 cell lysates.
(3 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Aurora A Antibody
- BSA Free
NBP1-51843
Western Blot: Aurora A Antibody [NBP1-51843] - WB detection of Aurora A in HeLa whole cell lysate.
Immunocytochemistry/Immunofluorescence: Aurora A Antibody [NBP1-51843] - HeLa cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti- (NBP1-51843) at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution overnight at 4C and detected with an anti-mouse Dylight 550 (Red) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunocytochemistry/Immunofluorescence: Aurora A Antibody [NBP1-51843] - IF Confocal analysis of HeLa cells using Aurora A antibody (NBP1-51843, 1:10). An Alexa Fluor 488-conjugated Goat to rabbit IgG was used as secondary antibody (green). Actin filaments were labeled with Alexa Fluor 568 phalloidin (red). DAPI was used to stain the cell nuclei (blue).
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
HES-1 Antibody
(OTI4H1)
NBP1-47791
Western Blot: HES-1 Antibody (OTI4H1) [NBP1-47791] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY HES1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-HES1 (1:500).
Immunocytochemistry/Immunofluorescence: HES-1 Antibody (OTI4H1) [NBP1-47791] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Hes1.
Immunocytochemistry/Immunofluorescence: HES-1 Antibody (OTI4H1) [NBP1-47791] - HeLa cells using anti-HES1 mouse monoclonal antibody.
(7 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
GATD3A Antibody
(1F5)
H00008209-M01
Immunocytochemistry/Immunofluorescence: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of monoclonal antibody to C21orf33 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of monoclonal antibody to C21orf33 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Sandwich ELISA: C21orf33 Antibody (1F5) [H00008209-M01] - Detection limit for recombinant GST tagged C21orf33 is approximately 0.03ng/ml as a capture antibody.
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
csl/RBPJK Antibody
NBP1-33427
Chromatin Immunoprecipitation (ChIP): csl/RBPJK Antibody [NBP1-33427] - Sheared, cross-linked chromatin was prepared from Jurkat T-ALL cells using the Covaris TruChIP kit and shearing with the LE220 sonicator. The chromatin buffer was adjusted to 150 mM NaCl, 20 mM Tris-Cl pH 8, 2 mM EDTA, and 1% Triton X-100. Three antibodies, as well as pure pre-immune rabbit IgG control, were added to each IP reaction, consisting of 7 million cells, and incubated overnight with mixing at 4 C. The antibodies were captured with Magna ChIP Protein A+G beads (Millipore), washed with three wash buffers, and the DNA eluted and purified with the iPure v2 kit (Diagenode). The purified DNA was normalized to the input control with qPCR quantification of the insulin exon 1 gene (INS) and an RBPJ binding site in the promoter of HES1. Image from verified customer review.
Western Blot: csl/RBPJK Antibody [NBP1-33427] - Sample (30 ug of whole cell lysate) A: Jurkat 7.5% SDS PAGE diluted at 1:2000
Immunocytochemistry/Immunofluorescence: csl/RBPJK Antibody [NBP1-33427] - Analysis of paraformaldehyde-fixed HeLa at 1:100 dilution.
(1 Review)
Species: Hu
Applications: ChIP, ICC/IF, WB
Jagged 1
[Unconjugated]
1277-JG
Jagged 1 [Unconjugated]
(42 Publications)
Species: Hu
Applications: BA
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(642 Publications)
Species: Hu
Applications: BA
Jagged 2
[Unconjugated]
1726-JG
Jagged 2 [Unconjugated]
(14 Publications)
Species: Hu
Applications: BA
DLL4 Antibody
[Unconjugated]
AF1389
Western blot shows lysates of bEnd.3 mouse endothelioma cell line. PVDF membrane was probed with 2 µg/mL of Goat Anti-Mouse DLL4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1389) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for DLL4 at approximately 90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
DLL4 was detected in immersion fixed bEnd.3 mouse endothelioma cell line using Goat Anti-Mouse DLL4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1389) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
DLL4 was detected in immersion fixed paraffin-embedded sections of mouse embryo (13 d.p.c.) using Goat Anti-Mouse DLL4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1389) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to developing vasculature. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(1 Review)
(28 Publications)
Species: Mu
Applications: ICC, IHC, WB
HEY1 Antibody
NBP2-16818
Western Blot: HEY1 Antibody [NBP2-16818] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with HEY1 antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Frozen: HEY1 Antibody [NBP2-16818] - Hey1 staining on E11.5 mouse Pharyngeal Mesoderm. Fixed 4% PFA overnight. Blocked with 1% BSA. Primary antibody dilution at 1:100. Secondary antibody at 1:1000, conjugated to Alexa Fluor 488. IHC-Fr image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: HEY1 Antibody [NBP2-16818] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: HEY1 protein stained by HEY1 antibody diluted at 1:2000. Red: alpha Tubulin, a cytoskeleton marker, stained by alpha Tubulin antibody [114] diluted at 1:1000. Blue: Hoechst 33342 staining.
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, WB
Pref-1/DLK1/FA1
Antibody (211309)
MAB1144
Pref‑1/DLK1/FA1 was detected in immersion fixed HepG2 human hepatocellular carcinoma cell line using Mouse Anti-Human Pref‑1/DLK1/FA1 Monoclonal Antibody (Catalog # MAB1144) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell membranes. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
HepG2 human hepatocellular carcinoma cell line was stained with Mouse Anti-Human Pref‑1/DLK1/FA1 Monoclonal Antibody (Catalog # MAB1144, filled histogram) or isotype control antibody (Catalog # MAB0041, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B).
(1 Review)
(4 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
HEY2 Antibody
NBP3-03905
Western Blot: HEY2 Antibody [NBP3-03905] - Analysis of extracts of various cell lines, using HEY2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.
Species: Hu, Mu, Rt
Applications: WB
HES5 Antibody -
BSA Free
NBP2-41305
Immunocytochemistry/Immunofluorescence: HES5 Antibody [NBP2-41305] - Staining of HES5 in mouse brain tissue with at 20 ug/mL.
Western Blot: HES5 Antibody [NBP2-41305] - Western blot analysis of HES5 in Raji cell lysate with HES5 antibody at 1 ug/ml (A) the absence and (B) the presence of blocking peptide.
Immunohistochemistry-Paraffin: HES5 Antibody [NBP2-41305] - Human spleen tissue with HES5 antibody at 5 ug/ml.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(23 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Analysis of Protein Array containing more than 19,000 full-length human proteins using HLA DQ/DR/DP Antibody (HLA-Pan/2967R). Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProt(TM) array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProt(TM) are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5.
Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).
Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Publications)
Species: Hu
Applications: BA
HTRA1/PRSS11
Antibody (275615)
MAB2916
Western blot shows lysates of human placenta tissue. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human HTRA1/PRSS11 Monoclonal Antibody (Catalog # MAB2916) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for HTRA1/PRSS11 at approximately 51 kDa (as indicated). This experiment was conducted under non-reducing conditions and using Immunoblot Buffer Group 1.
(11 Publications)
Species: Hu
Applications: IP, WB
Notch-3 Antibody
(1G5)
H00004854-M01
Notch-3 Antibody (1G5)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Notch-3 Antibody (H00004854-M01)(9)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 9 of 9.
Publications using H00004854-M01 Applications Species
Nagatoshi A, Ueda M, Ueda A et al. Serum amyloid P component: A novel potential player in vessel degeneration in CADASIL. J Neurol Sci 2017 May 26 [PMID: 28716282]
Zhang X, Wang YN, Zhu JJ et al. N-acetylcysteine negatively regulates Notch3 and its malignant signaling. Oncotarget. May 24 2016 [PMID: 27102435] (WB, Human) WB Human
Meng H, Zhang X, Lee SJ, Wang MM. Von Willebrand Factor Inhibits Mature Smooth Muscle Gene Expression through Impairment of Notch Signaling. PLoS One. 2013 Sep 23 [PMID: 24086636]
Dong H, Blaivas M, Wang MM. Bidirectional encroachment of collagen into the tunica media in cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Brain Res. 2012 Mar 23 [PMID: 22503071]
Tada M, Itoh S, Ishii-Watabe A et al. Functional analysis of the Notch ligand Jagged1 missense mutant proteins underlying Alagille syndrome. FEBS J. 2012 Apr 06 [PMID: 22487239]
Lee SJ, Meng H, Elmadhoun O et al. Cerebral Autosomal Dominant Arteriopathy With Subcortical Infarcts and Leukoencephalopathy Affecting an African American Man: Identification of a Novel 15-Base Pair NOTCH3 Duplication. Arch Neurol. 2011 Dec 01 [PMID: 22159056]
Watanabe-Hosomi A, Watanabe Y, Tanaka M et al. Transendocytosis is impaired in CADASIL-mutant NOTCH3. Exp Neurol. 2011 Oct 28 [PMID: 22079830]
Meng H, Zhang X, Hankenson KD et al. Thrombospondin2 potentiates notch3/Jagged1 signaling. J Biol Chem 284(12):7866-74. 2009 Mar 20. [PMID: 19147503]
Park JT, Shih IeM, Wang TL. Identification of Pbx1, a Potential Oncogene, as a Notch3 Target Gene in Ovarian Cancer. Cancer Res. 2008 Nov 01 [PMID: 18974129]

Review for Notch-3 Antibody (H00004854-M01) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using H00004854-M01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
  5
reviewed by:
System Admin
 WB Rat 05/26/2009
View

Summary

ApplicationWestern Blot
Sample TestedA7R5 cells
SpeciesRat
Lot08235-1G5

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Notch-3 Antibody (H00004854-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Notch-3 Products

Bioinformatics Tool for Notch-3 Antibody (H00004854-M01)

Discover related pathways, diseases and genes to Notch-3 Antibody (H00004854-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Notch-3 Antibody (H00004854-M01)

Discover more about diseases related to Notch-3 Antibody (H00004854-M01).
 

Pathways for Notch-3 Antibody (H00004854-M01)

View related products by pathway.

PTMs for Notch-3 Antibody (H00004854-M01)

Learn more about PTMs related to Notch-3 Antibody (H00004854-M01).
 

Research Areas for Notch-3 Antibody (H00004854-M01)

Find related products by research area.

Blogs on Notch-3

There are no specific blogs for Notch-3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
 
 System Admin
05/26/2009
Application: WB
Species: Rat
read this review

Bioinformatics

Gene Symbol NOTCH3
Entrez
Uniprot