Recombinant Human Niemann-Pick C1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Niemann-Pick C1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 151 - 250 of Human NPC1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GFANAMYNACRDVEAPSSNDKALGLLCGKDADACNATNWIEYMFNKDNGQAPFTITPVFSDFPVHGMEPMNNATKGCDESVDEVTAPCSCQDCSIVCGPK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NPC1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Niemann-Pick C1 Protein

  • FLJ98532
  • Niemann-Pick C1 protein
  • Niemann-Pick disease, type C1
  • NPC
  • NPC1

Background

NPC1 - Niemann-Pick disease, type C1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84012
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93329
Species: Hu
Applications: WB, ICC/IF, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl

Publications for Niemann-Pick C1 Partial Recombinant Protein (H00004864-Q01) (0)

There are no publications for Niemann-Pick C1 Partial Recombinant Protein (H00004864-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Niemann-Pick C1 Partial Recombinant Protein (H00004864-Q01) (0)

There are no reviews for Niemann-Pick C1 Partial Recombinant Protein (H00004864-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Niemann-Pick C1 Partial Recombinant Protein (H00004864-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking for a Niemann-Pick type1 or 2 antibody to stain mouse heart section embedded in paraffin. I would like to label these sections with another primary antibody to show colocalisation of my protein of interest. I would like to know if you have a rabbit anti-Niemann-Pick antibody that works well for fluorescence immunohistochemistry?
    • Niemann-Pick C1 Antibody (<a href="http://www.novusbio.com/NB400-148" target="_self">NB400-148</a>) (0.1 ml) is one of our best sellers and this antibody has been cited in at least 17 peer reviewed research publications in journals of high repute. We have only one Niemann-Pick type C2 antibody with catalog # <a href="http://www.novusbio.com/H00010577-D01P" target="_self">H00010577-D01P</a>, but this antibody is yet to be established for IHC application. However, if you would like to try this antibody for IHC-P application you would qualify for our Innovators Reward program. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product. Read more about <a href="http://www.novusbio.com/support/innovators-reward.html" target="_self">Innovators Reward Program</a>.

Additional Niemann-Pick C1 Products

Bioinformatics Tool for Niemann-Pick C1 Partial Recombinant Protein (H00004864-Q01)

Discover related pathways, diseases and genes to Niemann-Pick C1 Partial Recombinant Protein (H00004864-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Niemann-Pick C1 Partial Recombinant Protein (H00004864-Q01)

Discover more about diseases related to Niemann-Pick C1 Partial Recombinant Protein (H00004864-Q01).
 

Pathways for Niemann-Pick C1 Partial Recombinant Protein (H00004864-Q01)

View related products by pathway.

PTMs for Niemann-Pick C1 Partial Recombinant Protein (H00004864-Q01)

Learn more about PTMs related to Niemann-Pick C1 Partial Recombinant Protein (H00004864-Q01).
 

Research Areas for Niemann-Pick C1 Partial Recombinant Protein (H00004864-Q01)

Find related products by research area.

Blogs on Niemann-Pick C1

There are no specific blogs for Niemann-Pick C1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ABCA1 Antibody
NB400-105

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Niemann-Pick C1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NPC1