Recombinant Human Niemann-Pick C1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human Niemann-Pick C1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 151-250 of Human Niemann-Pick C1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GFANAMYNACRDVEAPSSNDKALGLLCGKDADACNATNWIEYMFNKDNGQAPFTITPVFSDFPVHGMEPMNNATKGCDESVDEVTAPCSCQDCSIVCGPK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
NPC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Niemann-Pick C1 GST (N-Term) Protein

  • FLJ98532
  • Niemann-Pick C1 protein
  • Niemann-Pick disease, type C1
  • Niemann-Pick Type C1
  • NPC
  • NPC1
  • SLC65A1

Background

NPC1 - Niemann-Pick disease, type C1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-84012
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-93935
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-83213
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-84841
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
DY4517-05
Species: Mu
Applications: ELISA
NB120-2938
Species: Bv, Hu, Mu
Applications: IHC,  IHC-P, WB
NB100-93329
Species: Hu
Applications: ICC/IF, IP, KO, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PCR, Simple Western, WB
DBD00
Species: Hu
Applications: ELISA
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
M6000B
Species: Mu
Applications: ELISA
H00004864-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Niemann-Pick C1 Partial Recombinant Protein (H00004864-Q01) (0)

There are no publications for Niemann-Pick C1 Partial Recombinant Protein (H00004864-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Niemann-Pick C1 Partial Recombinant Protein (H00004864-Q01) (0)

There are no reviews for Niemann-Pick C1 Partial Recombinant Protein (H00004864-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Niemann-Pick C1 Partial Recombinant Protein (H00004864-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking for a Niemann-Pick type1 or 2 antibody to stain mouse heart section embedded in paraffin. I would like to label these sections with another primary antibody to show colocalisation of my protein of interest. I would like to know if you have a rabbit anti-Niemann-Pick antibody that works well for fluorescence immunohistochemistry?
    • Niemann-Pick C1 Antibody (<a href="http://www.novusbio.com/NB400-148" target="_self">NB400-148</a>) (0.1 ml) is one of our best sellers and this antibody has been cited in at least 17 peer reviewed research publications in journals of high repute. We have only one Niemann-Pick type C2 antibody with catalog # <a href="http://www.novusbio.com/H00010577-D01P" target="_self">H00010577-D01P</a>, but this antibody is yet to be established for IHC application. However, if you would like to try this antibody for IHC-P application you would qualify for our Innovators Reward program. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product. Read more about <a href="http://www.novusbio.com/support/innovators-reward.html" target="_self">Innovators Reward Program</a>.

Additional Niemann-Pick C1 Products

Research Areas for Niemann-Pick C1 Partial Recombinant Protein (H00004864-Q01)

Find related products by research area.

Blogs on Niemann-Pick C1.

NPC1: A Potential Target For Triple-Negative Breast Cancer
By Natalia Gurule, PhD Breast Cancer is a Heterogeneous DiseaseBreast cancer is the most frequently identified malignancy in women, accounting for 30% of diagnosed cases of cancer in women in the US annuall...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Niemann-Pick C1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NPC1