Recombinant Human Niemann-Pick C1 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, AP

Recombinant Human Niemann-Pick C1 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 151-250 of Human Niemann-Pick C1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: GFANAMYNACRDVEAPSSNDKALGLLCGKDADACNATNWIEYMFNKDNGQAPFTITPVFSDFPVHGMEPMNNATKGCDESVDEVTAPCSCQDCSIVCGPK

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: NPC1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 36.63 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Niemann-Pick C1 GST (N-Term) Protein

• FLJ98532
• Niemann-Pick C1 protein
• Niemann-Pick disease, type C1
• Niemann-Pick Type C1
• NPC
• NPC1
• SLC65A1

Background

NPC1 - Niemann-Pick disease, type C1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for Niemann-Pick C1 Partial Recombinant Protein (H00004864-Q01). (Showing 1 - 1 of 1 FAQ).

1. I'm looking for a Niemann-Pick type1 or 2 antibody to stain mouse heart section embedded in paraffin. I would like to label these sections with another primary antibody to show colocalisation of my protein of interest. I would like to know if you have a rabbit anti-Niemann-Pick antibody that works well for fluorescence immunohistochemistry?
   • Niemann-Pick C1 Antibody (<a href="http://www.novusbio.com/NB400-148" target="_self">NB400-148</a>) (0.1 ml) is one of our best sellers and this antibody has been cited in at least 17 peer reviewed research publications in journals of high repute. We have only one Niemann-Pick type C2 antibody with catalog # <a href="http://www.novusbio.com/H00010577-D01P" target="_self">H00010577-D01P</a>, but this antibody is yet to be established for IHC application. However, if you would like to try this antibody for IHC-P application you would qualify for our Innovators Reward program. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product. Read more about <a href="http://www.novusbio.com/support/innovators-reward.html" target="_self">Innovators Reward Program</a>.

Bioinformatics

• Gene Symbol: NPC1