AGFG2 Antibody

Images

 
Western Blot: AGFG2 Antibody [NBP1-83213] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: AGFG2 Antibody [NBP1-83213] - Staining in human salivary gland and skeletal muscle tissues using anti-AGFG2 antibody. Corresponding AGFG2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: AGFG2 Antibody [NBP1-83213] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.
Immunohistochemistry-Paraffin: AGFG2 Antibody [NBP1-83213] - Staining of human salivary gland shows high expression.
Immunohistochemistry-Paraffin: AGFG2 Antibody [NBP1-83213] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AGFG2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FGAFTNPFTAPAAQSPLPSTNPFQPNGLAPGPGFGMSSAGPGFPQAVPPTGAFASSFPAPLFPPQTPLVQQQNGSSFGDLGSAKLGQRPLSQPAGISTNPFMTGPSSSPFASKPPTTN
Specificity
Specificity of human AGFG2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AGFG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
AGFG2 Protein (NBP1-83213PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AGFG2 Antibody

  • ArfGAP with FG repeats 2
  • HIV-1 Rev binding protein-like
  • HIV-1 Rev-binding protein-like protein
  • HRBLnucleoporin
  • RAB-R
  • RABRarf-GAP domain and FG repeats-containing protein 2
  • Rev/Rex activation domain binding protein-related
  • Rev/Rex activation domain-binding protein related

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P, KO
NB120-2938
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P
NBP1-31381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-61832
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-93325
Species: Hu
Applications: WB, IP
NBP2-38645
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-48320
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2244
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ICC, IF
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-93329
Species: Hu
Applications: WB, ICC/IF, IP, KO
NBP1-57160
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-81546
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-76927
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-82520
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82525
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-66340
Species: Hu
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P

Publications for AGFG2 Antibody (NBP1-83213) (0)

There are no publications for AGFG2 Antibody (NBP1-83213).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AGFG2 Antibody (NBP1-83213) (0)

There are no reviews for AGFG2 Antibody (NBP1-83213). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AGFG2 Antibody (NBP1-83213) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for AGFG2 Antibody (NBP1-83213)

Discover related pathways, diseases and genes to AGFG2 Antibody (NBP1-83213). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGFG2 Antibody (NBP1-83213)

Discover more about diseases related to AGFG2 Antibody (NBP1-83213).

Blogs on AGFG2.

Niemann Pick-C1 and cholesterol dynamics
Niemann-Pick type C1 (NPC1) mediates low-density cholesterol transport from late endosomes and lysosomes to other areas of the cell via receptor mediation endocytosis.  Although cholesterol moves freely inside the cell, it cannot independently expo...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AGFG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AGFG2
Entrez
Uniprot