AGFG2 Antibody

Western Blot: AGFG2 Antibody [NBP1-83213] - Analysis in control (vector only transfected HEK293T lysate) and AGFG2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: AGFG2 Antibody [NBP1-83213] - Staining in human salivary gland and skeletal muscle tissues using anti-AGFG2 antibody. Corresponding AGFG2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: AGFG2 Antibody [NBP1-83213] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.

Immunohistochemistry-Paraffin: AGFG2 Antibody [NBP1-83213] - Staining of human salivary gland shows high expression.

Immunohistochemistry-Paraffin: AGFG2 Antibody [NBP1-83213] - Staining of human skeletal muscle shows low expression as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

AGFG2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FGAFTNPFTAPAAQSPLPSTNPFQPNGLAPGPGFGMSSAGPGFPQAVPPTGAFASSFPAPLFPPQTPLVQQQNGSSFGDLGSAKLGQRPLSQPAGISTNPFMTGPSSSPFASKPPTTN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AGFG2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 49 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  AGFG2 Protein (NBP1-83213PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AGFG2 Antibody

• ArfGAP with FG repeats 2
• HIV-1 Rev binding protein-like
• HIV-1 Rev-binding protein-like protein
• HRBLnucleoporin
• RAB-R
• RABRarf-GAP domain and FG repeats-containing protein 2
• Rev/Rex activation domain binding protein-related
• Rev/Rex activation domain-binding protein related

Background

AGFG2 codes for a protein is 481 amino acids long and weighs approximately 49 kDa, with a short isoform with a length of 156 amino acids and a weight of approximately 17 kDa. AGFG2 codes for a protein that helps control the necleocytoplasmic transfer of proteins and RNAs, which is a process known as the Rev export pathway. Current studies are being done on several diseases and disorders relating to this gene, including xerophthalmia and bronchiectasis. AGFG2 has also been shown to have interactions with EPS15L1, EPS15, and ITSN1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AGFG2
• Entrez:
  • 3268(Human)
• Uniprot:
  • O95081(Human)