PDLIM7 Antibody

Images

 
Western Blot: PDLIM7 Antibody [NBP1-84841] - Analysis in human cell lines U2OS and HEK293 using Anti-PDLIM7 antibody. Corresponding PDLIM7 RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: PDLIM7 Antibody [NBP1-84841] - Immunofluorescent staining of human cell line U-251 MG shows localization to actin filaments & focal adhesion sites.
Immunohistochemistry-Paraffin: PDLIM7 Antibody [NBP1-84841] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
Western Blot: PDLIM7 Antibody [NBP1-84841] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDLIM7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HLTGTEFMQDPDEEHLKKSSQVPRTEAPAPASSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLTR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDLIM7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PDLIM7 Protein (NBP1-84841PEP)
Publications
Read Publication using NBP1-84841.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22253135)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDLIM7 Antibody

  • 1110003B01Rik
  • ENIGMAProtein enigma
  • LIM domain protein
  • LIM mineralization protein
  • LMP
  • LMP1
  • PDZ and LIM domain 7 (enigma)
  • PDZ and LIM domain protein 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NB100-56654
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84841
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PDLIM7 Antibody (NBP1-84841)(1)

Reviews for PDLIM7 Antibody (NBP1-84841) (0)

There are no reviews for PDLIM7 Antibody (NBP1-84841). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PDLIM7 Antibody (NBP1-84841) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDLIM7 Products

Bioinformatics Tool for PDLIM7 Antibody (NBP1-84841)

Discover related pathways, diseases and genes to PDLIM7 Antibody (NBP1-84841). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDLIM7 Antibody (NBP1-84841)

Discover more about diseases related to PDLIM7 Antibody (NBP1-84841).
 

Pathways for PDLIM7 Antibody (NBP1-84841)

View related products by pathway.

PTMs for PDLIM7 Antibody (NBP1-84841)

Learn more about PTMs related to PDLIM7 Antibody (NBP1-84841).

Blogs on PDLIM7

There are no specific blogs for PDLIM7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDLIM7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDLIM7