ARHGAP4 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining in human spleen and cerebral cortex tissues using anti-ARHGAP4 antibody. Corresponding ARHGAP4 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human colon, liver, lymph node and testis using Anti-ARHGAP4 antibody NBP1-88527 (A) shows similar protein ...read more
Western Blot: ARHGAP4 Antibody [NBP1-88527] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human colon.
Western Blot: ARHGAP4 Antibody [NBP1-88527] - Analysis in human cell line RPMI-8226.
Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human spleen shows high expression.
Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human liver.
Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human lymph node.
Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human testis.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGAP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EHNGMRGLIPHKYITLPAGTEKQVVGAGLQTAGESGSSPEGLLASELVHRPEPCTSPEAMGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGAP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARHGAP4 Protein (NBP1-88527PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGAP4 Antibody

  • RGC1
  • Rho GTPase activating protein 4

Background

The ARHGAP4 gene encodes a member of the rhoGAP family of proteins which play a role in the regulation of small GTP-bindingproteins belonging to the RAS superfamily. The protein encoded by the orthologous gene in rat is localized to theGolgi complex and can redi

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARHGAP4 Antibody (NBP1-88527) (0)

There are no publications for ARHGAP4 Antibody (NBP1-88527).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGAP4 Antibody (NBP1-88527) (0)

There are no reviews for ARHGAP4 Antibody (NBP1-88527). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARHGAP4 Antibody (NBP1-88527) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGAP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP4