Niemann-Pick type C2 Antibody

Images

 
Western Blot: Niemann-Pick type C2 Antibody [NBP1-84012] - Analysis in human cell lines U2OS and HeLa using Anti-NPC2 antibody. Corresponding NPC2 RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunohistochemistry-Paraffin: Niemann-Pick type C2 Antibody [NBP1-84012] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.
Western Blot: Niemann-Pick type C2 Antibody [NBP1-84012] - Analysis in human cell line RT-4.
Western Blot: Niemann-Pick type C2 Antibody [NBP1-84012] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
       

Orthogonal Strategies

 

Order Details

Niemann-Pick type C2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Niemann-Pick type C2 Protein (NBP1-84012PEP)
Reviewed Applications
Read 1 Review rated 1
using
NBP1-84012 in the following applications:

Publications
Read Publications using NBP1-84012.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23843985)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Niemann-Pick type C2 Antibody

  • EDDM1
  • Epididymal Protein 1
  • epididymal secretory protein E1
  • HE1
  • HE1epididymal protein 1
  • Human epididymis-specific protein 1
  • MGC1333
  • Niemann-Pick disease type C2 protein
  • Niemann-Pick disease, type C2
  • NiemannPick Type C2
  • Niemann-Pick Type C2
  • NPC2
  • NP-C2
  • tissue-specific secretory protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-52645
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, CyTOF-ready
NB100-56655
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP2-46360
Species: Hu
Applications: WB, IHC
NBP2-45889
Species: Hu
Applications: WB, IHC
AF1029
Species: Mu
Applications: WB, IHC, IP
NBP1-98296
Species: Hu
Applications: WB
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24950
Species: Hu, Mu, Rt
Applications: WB
NB400-128
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-02192
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for Niemann-Pick type C2 Antibody (NBP1-84012)(3)

Review for Niemann-Pick type C2 Antibody (NBP1-84012) (1) 11

Average Rating: 1
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: ICC.

Reviews using NBP1-84012:
Filter by Applications
ICC
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry Niemann-Pick type C2 NBP1-84012
Enlarge
reviewed by:
jian li
ICC Human 06/14/2017
View

Summary

ApplicationImmunocytochemistry
Sample Tested hela cell
SpeciesHuman
LotB104871

Comments

Commentsfor LAMP1 staining, mouse anti LAMP1 antibody was used followed by AF488 anti mouse secondary.
For NPC2 stating, rabbit anti NPC2 was used with 1:100 dilution followed by AF568 anti rabbit secondary.

shown is a merged image of LAMP1 (GREEN) and NPC2 (RED)

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Niemann-Pick type C2 Antibody (NBP1-84012). (Showing 1 - 1 of 1 FAQs).

  1. I'm looking for a Niemann-Pick type1 or 2 antibody to stain mouse heart section embedded in paraffin. I would like to label these sections with another primary antibody to show colocalisation of my protein of interest. I would like to know if you have a rabbit anti-Niemann-Pick antibody that works well for fluorescence immunohistochemistry?
    • Niemann-Pick C1 Antibody (NB400-148) (0.1 ml) is one of our best sellers and this antibody has been cited in at least 17 peer reviewed research publications in journals of high repute. We have only one Niemann-Pick type C2 antibody with catalog # H00010577-D01PInnovators Reward Program.

Secondary Antibodies

 

Isotype Controls

Additional Niemann-Pick type C2 Products

Bioinformatics Tool for Niemann-Pick type C2 Antibody (NBP1-84012)

Discover related pathways, diseases and genes to Niemann-Pick type C2 Antibody (NBP1-84012). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Niemann-Pick type C2 Antibody (NBP1-84012)

Discover more about diseases related to Niemann-Pick type C2 Antibody (NBP1-84012).
 

Pathways for Niemann-Pick type C2 Antibody (NBP1-84012)

View related products by pathway.

PTMs for Niemann-Pick type C2 Antibody (NBP1-84012)

Learn more about PTMs related to Niemann-Pick type C2 Antibody (NBP1-84012).

Blogs on Niemann-Pick type C2

There are no specific blogs for Niemann-Pick type C2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

1
5
0
4
0
3
0
2
0
1
1

jian li
06/14/2017
Application: ICC
Species: Human

Bioinformatics

Gene Symbol NPC2
Entrez