Niemann-Pick C1 Antibody (4H2) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
NPC1 (AAH63302, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GFANAMYNACRDVEAPSSNDKALGLLCGKDADACNATNWIEYMFNKDNGQAPFTITPVFSDFPVHGMEPMNNATKGCDESVDEVTAPCSCQDCSIVCGPK |
| Localization |
Late endosome and Lysosome membrane; Single-pass membrane protein. |
| Specificity |
NPC1 - Niemann-Pick disease, type C1 |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
NPC1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Niemann-Pick C1 Antibody (4H2) - Azide and BSA Free
Background
This gene was identified as the gene that when mutated, results in Niemann-Pick C disease. The encoded protein is a putative integral membrane protein that contains motifs consistent with a role in intracellular transport of cholesterol to post-lysosomal destinations.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Bv, Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IP, KO, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: WB, ELISA
Publications for Niemann-Pick C1 Antibody (H00004864-M02)(6)
Showing Publications 1 -
6 of 6.
| Publications using H00004864-M02 |
Applications |
Species |
| Lund RR, Leth-Larsen R, Caterino TD et al. NADH-cytochrome b5 reductase 3 promotes colonization and metastasis formation and is a prognostic marker of disease-free and overall survival in estrogen receptor-negative breast cancer. Mol Cell Proteomics. 2015-09-08 [PMID: 26351264] |
|
|
| Erwood S, Brewer RA, Bily TMI et al. Modelling Niemann-Pick disease type C in a human haploid cell line allows for patient variant characterization and clinical interpretation bioRxiv |
|
|
| Tang Y, Leao IC, Coleman EM et al. Deficiency of niemann-pick type C-1 protein impairs release of human immunodeficiency virus type 1 and results in Gag accumulation in late endosomal/lysosomal compartments. J Virol 2009-08-01 [PMID: 19474101] |
|
|
| Erwood, S; Applying Precision Genome Editing Technologies to Variant Effect Interpretation Thesis |
|
|
| Erwood, S; Applying Precision Genome Editing Technologies to Variant Effect Interpretation Nat Biotechnol 2022-02-15 [PMID: 35165384] |
|
|
| Erwood S, Brewer RA, Bily TMI et al. Modelling Niemann-Pick disease type C in a human haploid cell line allows for patient variant characterization and clinical interpretation Genome Res 2019-11-23 [PMID: 31754021] |
|
|
Reviews for Niemann-Pick C1 Antibody (H00004864-M02) (0)
There are no reviews for Niemann-Pick C1 Antibody (H00004864-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Niemann-Pick C1 Antibody (H00004864-M02). (Showing 1 - 1 of 1 FAQs).
-
I'm looking for a Niemann-Pick type1 or 2 antibody to stain mouse heart section embedded in paraffin. I would like to label these sections with another primary antibody to show colocalisation of my protein of interest. I would like to know if you have a rabbit anti-Niemann-Pick antibody that works well for fluorescence immunohistochemistry?
- Niemann-Pick C1 Antibody (<a href="http://www.novusbio.com/NB400-148" target="_self">NB400-148</a>) (0.1 ml) is one of our best sellers and this antibody has been cited in at least 17 peer reviewed research publications in journals of high repute. We have only one Niemann-Pick type C2 antibody with catalog # <a href="http://www.novusbio.com/H00010577-D01P" target="_self">H00010577-D01P</a>, but this antibody is yet to be established for IHC application. However, if you would like to try this antibody for IHC-P application you would qualify for our Innovators Reward program. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product. Read more about <a href="http://www.novusbio.com/support/innovators-reward.html" target="_self">Innovators Reward Program</a>.