Niemann-Pick C1 Antibody (4H2)

Images

 
Western Blot: Niemann-Pick C1 Antibody (4H2) [H00004864-M02] - NPC1 monoclonal antibody (M02), clone 4H2. Analysis of NPC1 expression in HeLa.
ELISA: Niemann-Pick C1 Antibody (4H2) [H00004864-M02] - Detection limit for recombinant GST tagged NPC1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4H2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Niemann-Pick C1 Antibody (4H2) Summary

Immunogen
NPC1 (AAH63302, 151 a.a. - 250 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GFANAMYNACRDVEAPSSNDKALGLLCGKDADACNATNWIEYMFNKDNGQAPFTITPVFSDFPVHGMEPMNNATKGCDESVDEVTAPCSCQDCSIVCGPK
Localization
Late endosome and Lysosome membrane; Single-pass membrane protein.
Specificity
NPC1 - Niemann-Pick disease, type C1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NPC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publications using H00004864-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Niemann-Pick C1 Antibody (4H2)

  • FLJ98532
  • Niemann-Pick C1 protein
  • Niemann-Pick disease, type C1
  • NPC
  • NPC1

Background

This gene was identified as the gene that when mutated, results in Niemann-Pick C disease. The encoded protein is a putative integral membrane protein that contains motifs consistent with a role in intracellular transport of cholesterol to post-lysosomal destinations.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84012
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93329
Species: Hu
Applications: WB, ICC/IF, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl

Publications for Niemann-Pick C1 Antibody (H00004864-M02)(2)

Reviews for Niemann-Pick C1 Antibody (H00004864-M02) (0)

There are no reviews for Niemann-Pick C1 Antibody (H00004864-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Niemann-Pick C1 Antibody (H00004864-M02). (Showing 1 - 1 of 1 FAQs).

  1. I'm looking for a Niemann-Pick type1 or 2 antibody to stain mouse heart section embedded in paraffin. I would like to label these sections with another primary antibody to show colocalisation of my protein of interest. I would like to know if you have a rabbit anti-Niemann-Pick antibody that works well for fluorescence immunohistochemistry?
    • Niemann-Pick C1 Antibody (<a href="http://www.novusbio.com/NB400-148" target="_self">NB400-148</a>) (0.1 ml) is one of our best sellers and this antibody has been cited in at least 17 peer reviewed research publications in journals of high repute. We have only one Niemann-Pick type C2 antibody with catalog # <a href="http://www.novusbio.com/H00010577-D01P" target="_self">H00010577-D01P</a>, but this antibody is yet to be established for IHC application. However, if you would like to try this antibody for IHC-P application you would qualify for our Innovators Reward program. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product. Read more about <a href="http://www.novusbio.com/support/innovators-reward.html" target="_self">Innovators Reward Program</a>.

Secondary Antibodies

 

Isotype Controls

Additional Niemann-Pick C1 Products

Bioinformatics Tool for Niemann-Pick C1 Antibody (H00004864-M02)

Discover related pathways, diseases and genes to Niemann-Pick C1 Antibody (H00004864-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Niemann-Pick C1 Antibody (H00004864-M02)

Discover more about diseases related to Niemann-Pick C1 Antibody (H00004864-M02).
 

Pathways for Niemann-Pick C1 Antibody (H00004864-M02)

View related products by pathway.

PTMs for Niemann-Pick C1 Antibody (H00004864-M02)

Learn more about PTMs related to Niemann-Pick C1 Antibody (H00004864-M02).
 

Research Areas for Niemann-Pick C1 Antibody (H00004864-M02)

Find related products by research area.

Blogs on Niemann-Pick C1

There are no specific blogs for Niemann-Pick C1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Niemann-Pick C1 Antibody (4H2) and receive a gift card or discount.

Bioinformatics

Gene Symbol NPC1
Entrez
OMIM
Uniprot