SNRPN Antibody

Images

 
Western Blot: SNRPN Antibody [NBP1-83280] - Analysis in human cell line NTERA-2.
Immunohistochemistry-Paraffin: SNRPN Antibody [NBP1-83280] - Staining of human lateral ventricle shows strong nuclear positivity in neuronal cells and glial cells.
Western Blot: SNRPN Antibody [NBP1-83280] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Product Discontinued
View other related SNRPN Primary Antibodies

Order Details


    • Catalog Number
      NBP1-83280
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SNRPN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGVGRAAGRGVPAGVPIPQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNRPN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Publications
Read Publication using
NBP1-83280 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25571951).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNRPN Antibody

  • DKFZp686C0927
  • DKFZp686M12165
  • DKFZp761I1912
  • DKFZp762N022
  • FLJ39265
  • HCERN3FLJ33569
  • MGC29886
  • Prader-Willi syndrome chromosome region
  • PWCR
  • RT-LI
  • Sm protein D
  • Sm protein N
  • small nuclear ribonucleoprotein polypeptide N
  • small nuclear ribonucleoprotein-associated protein N
  • SM-D
  • SmN
  • sm-N
  • SMNFLJ36996
  • SNRNP-N
  • SNURF-SNRPN
  • tissue-specific splicing protein
  • Tissue-specific-splicing protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB829
Species: Hu
Applications: WB, IHC
NBP1-77177
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC, IF
NBP2-52453
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-15939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-44050
Species: Mu, Rt
Applications: WB, PEP-ELISA
NB500-240
Species: Hu, Mu
Applications: WB, IP
NBP2-47624
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-514
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-46117
Species: Hu
Applications: WB, IHC, IF
NBP1-84320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008926-B01P
Species: Hu
Applications: WB, ICC/IF
H00006047-A01
Species: Hu
Applications: WB, ELISA
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83280
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SNRPN Antibody (NBP1-83280)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SNRPN Antibody (NBP1-83280) (0)

There are no reviews for SNRPN Antibody (NBP1-83280). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNRPN Antibody (NBP1-83280) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNRPN Products

Bioinformatics Tool for SNRPN Antibody (NBP1-83280)

Discover related pathways, diseases and genes to SNRPN Antibody (NBP1-83280). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNRPN Antibody (NBP1-83280)

Discover more about diseases related to SNRPN Antibody (NBP1-83280).
 

Pathways for SNRPN Antibody (NBP1-83280)

View related products by pathway.

PTMs for SNRPN Antibody (NBP1-83280)

Learn more about PTMs related to SNRPN Antibody (NBP1-83280).

Blogs on SNRPN

There are no specific blogs for SNRPN, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNRPN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNRPN