GEMIN6 Antibody - Azide and BSA Free

Western Blot: GEMIN6 Antibody [H00079833-B01P] - Analysis of GEMIN6 expression in HeLa.

Immunocytochemistry/Immunofluorescence: GEMIN6 Antibody [H00079833-B01P] - Analysis of purified antibody to GEMIN6 on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: GEMIN6 Antibody [H00079833-B01P] - Analysis of GEMIN6 expression in transfected 293T cell line by GEMIN6 polyclonal antibody. Lane 1: GEMIN6 transfected lysate(18.37 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GEMIN6 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse GEMIN6 Antibody - Azide and BSA Free (H00079833-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: GEMIN6 (AAH18195.1, 1 a.a. - 167 a.a.) full-length human protein. MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYDPENCSSSNEIILSRVQDLIEGHLTASQ
• Specificity: GEMIN6 - gem (nuclear organelle) associated protein 6,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: GEMIN6
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. Has also been used for immunofluorescence.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GEMIN6 Antibody - Azide and BSA Free

• FLJ23459
• gem (nuclear organelle) associated protein 6
• gem-associated protein 6
• gemin 6
• gemin-6
• SIP2

Background

GEMIN6 is part of a large macromolecular complex, localized to both the cytoplasm and the nucleus, that plays a role in the cytoplasmic assembly of small nuclear ribonucleoproteins (snRNPs). Other members of this complex include SMN (MIM 600354), GEMIN2 (SIP1; MIM 602595), GEMIN3 (DDX20; MIM 606168), GEMIN4 (MIM 606969), and GEMIN5 (MIM 607005).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GEMIN6
• Entrez:
  • 79833(Human)
• Uniprot:
  • AAH18195.1(Human)