NeuroD1 Antibody

Images

 
Western Blot: NeuroD1 Antibody [NBP1-88661] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: NeuroD1 Antibody [NBP1-88661] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NeuroD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFTMHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEUROD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NeuroD1 Protein (NBP1-88661PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NeuroD1 Antibody

  • basic helix-loop-helix transcription factor
  • BETA2
  • BHF-1
  • BHLHA3
  • bHLHa3beta-cell E-box transactivator 2
  • Class A basic helix-loop-helix protein 3
  • MODY6
  • NeuroD
  • NeuroD1
  • neurogenic differentiation 1
  • neurogenic differentiation factor 1
  • neurogenic helix-loop-helix protein NEUROD
  • NIDDM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
AF3444
Species: Hu
Applications: WB
AF2567
Species: Mu
Applications: WB, IHC
NBP1-47871
Species: Hu, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3314
Species: Hu, Rt
Applications: IHC
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2775
Species: Hu, Mu
Applications: WB
NBP1-49672
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF2614
Species: Hu
Applications: WB, ICC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
AF6014
Species: Hu, Mu, Rt
Applications: WB
AF6116
Species: Hu
Applications: WB, ICC
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82554
Species: Hu
Applications: WB, IHC, IHC-P
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow

Publications for NeuroD1 Antibody (NBP1-88661) (0)

There are no publications for NeuroD1 Antibody (NBP1-88661).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NeuroD1 Antibody (NBP1-88661) (0)

There are no reviews for NeuroD1 Antibody (NBP1-88661). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NeuroD1 Antibody (NBP1-88661) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NeuroD1 Products

Bioinformatics Tool for NeuroD1 Antibody (NBP1-88661)

Discover related pathways, diseases and genes to NeuroD1 Antibody (NBP1-88661). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NeuroD1 Antibody (NBP1-88661)

Discover more about diseases related to NeuroD1 Antibody (NBP1-88661).
 

Pathways for NeuroD1 Antibody (NBP1-88661)

View related products by pathway.

PTMs for NeuroD1 Antibody (NBP1-88661)

Learn more about PTMs related to NeuroD1 Antibody (NBP1-88661).
 

Research Areas for NeuroD1 Antibody (NBP1-88661)

Find related products by research area.

Blogs on NeuroD1

There are no specific blogs for NeuroD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NeuroD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NEUROD1
Entrez