NDC80 Antibody

Images

 
Western Blot: NDC80 Antibody [NBP2-56920] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: NDC80 Antibody [NBP2-56920] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDC80 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLKASLQGDVQKYQ
Specificity
Specificity of human NDC80 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDC80
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NDC80 Recombinant Protein Antigen (NBP2-56920PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NDC80 Antibody

  • HEC1KNTC2
  • HECRetinoblastoma-associated protein HEC
  • Highly expressed in cancer protein
  • highly expressed in cancer, rich in leucine heptad repeats (yeast)
  • highly expressed in cancer, rich in leucine heptad repeats
  • hsHec1
  • hsNDC80
  • kinetochore associated 2
  • Kinetochore protein Hec1
  • kinetochore protein NDC80 homolog
  • Kinetochore-associated protein 2
  • NDC80 homolog, kinetochore complex component (S. cerevisiae)
  • TID3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31632
Species: Hu
Applications: WB, ICC/IF
NBP2-47264
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NB100-563
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2359
Species: Hu
Applications: WB, IHC, IP
NBP2-47263
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88626
Species: Hu
Applications: IHC, IHC-P
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-89979
Species: Hu
Applications: IHC, IHC-P
NB100-2586
Species: Hu
Applications: WB, ICC/IF, IP
NB110-40681
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-82546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6028
Species: Hu
Applications: WB, IHC
AF1730
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready, ICC
NBP2-56920
Species: Hu
Applications: WB, ICC/IF

Publications for NDC80 Antibody (NBP2-56920) (0)

There are no publications for NDC80 Antibody (NBP2-56920).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDC80 Antibody (NBP2-56920) (0)

There are no reviews for NDC80 Antibody (NBP2-56920). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDC80 Antibody (NBP2-56920) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NDC80 Products

Bioinformatics Tool for NDC80 Antibody (NBP2-56920)

Discover related pathways, diseases and genes to NDC80 Antibody (NBP2-56920). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDC80 Antibody (NBP2-56920)

Discover more about diseases related to NDC80 Antibody (NBP2-56920).
 

Pathways for NDC80 Antibody (NBP2-56920)

View related products by pathway.

PTMs for NDC80 Antibody (NBP2-56920)

Learn more about PTMs related to NDC80 Antibody (NBP2-56920).
 

Research Areas for NDC80 Antibody (NBP2-56920)

Find related products by research area.

Blogs on NDC80

There are no specific blogs for NDC80, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDC80 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDC80