NDC80 Antibody - BSA Free

Western Blot: NDC80 Antibody [NBP2-56920] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: NDC80 Antibody [NBP2-56920] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NDC80 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NDC80 Antibody - BSA Free (NBP2-56920) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLKASLQGDVQKYQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDC80
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NDC80 Recombinant Protein Antigen (NBP2-56920PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NDC80 Antibody - BSA Free

• HEC1KNTC2
• HECRetinoblastoma-associated protein HEC
• Highly expressed in cancer protein
• highly expressed in cancer, rich in leucine heptad repeats (yeast)
• highly expressed in cancer, rich in leucine heptad repeats
• hsHec1
• hsNDC80
• kinetochore associated 2
• Kinetochore protein Hec1
• kinetochore protein NDC80 homolog
• Kinetochore-associated protein 2
• NDC80 homolog, kinetochore complex component (S. cerevisiae)
• TID3

Background

Human HEC1 is a coiled-coil protein that has been demonstrated to have a role in M-phase progression. It is essential for proper chromosome segregation. Its depletion results in the impairment of chromosome congression and results in spindle checkpoint activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDC80