SPC25 Antibody

Images

 
Western Blot: SPC25 Antibody [NBP2-47263] - Analysis in human cell line U-2 OS.
Immunocytochemistry/ Immunofluorescence: SPC25 Antibody [NBP2-47263] - Staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: SPC25 Antibody [NBP2-47263] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPC25 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFTATVY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPC25
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPC25 Protein (NBP2-47263PEP)
Publications
Read Publication using NBP2-47263.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPC25 Antibody

  • AD024
  • hSpc25
  • kinetochore protein Spc25
  • MGC22228,2600017H08Rik
  • SPBC25
  • SPC25, NDC80 kinetochore complex component, homolog (S. cerevisiae)
  • spindle pole body component 25 homolog (S. cerevisiae)
  • spindle pole body component 25 homolog

Background

SPC25 encodes a protein that may be involved in kinetochore-microtubule interaction and spindle checkpoint activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SPC25 Antibody (NBP2-47263)(1)

Reviews for SPC25 Antibody (NBP2-47263) (0)

There are no reviews for SPC25 Antibody (NBP2-47263). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPC25 Antibody (NBP2-47263) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPC25 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPC25