SPC24 Antibody - BSA Free

Western Blot: SPC24 Antibody [NBP2-47264] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.

Immunocytochemistry/Immunofluorescence: SPC24 Antibody [NBP2-47264] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli.

Staining of human lymph node shows moderate nuclear positivity in germinal center cells.

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Staining of human fallopian tube shows weak nuclear positivity in glandular cells.

Staining of human kidney shows negative nuclear positivity in cells in tubules and cells in glomeruli as expected.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SPC24 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SPC24 Antibody - BSA Free (NBP2-47264) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SPC24 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLV
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPC24
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SPC24 Protein (NBP2-47264PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SPC24 Antibody - BSA Free

• FLJ90806
• hSpc24
• kinetochore protein Spc24
• SPBC24
• SPC24, NDC80 kinetochore complex component, homolog (S. cerevisiae)
• spindle pole body component 24 homolog (S. cerevisiae)
• spindle pole body component 24 homolog

Background

SPC24 acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosomesegregation and spindle checkpoint activity. Required for kinetochore integrity and the organization of stablemicrotubule binding sites in the outer

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SPC24 Antibody (NBP2-47264)(1)

Publication using NBP2-47264

• Chen J, Luo J, He J et al. Cell Cycle-Related Gene SPC24: A Novel Potential Diagnostic and Prognostic Biomarker for Laryngeal Squamous Cell Cancer BioMed Research International 2023-01-21 [PMID: 36718148]

Bioinformatics

• Gene Symbol: SPC24