SPC24 Antibody


Western Blot: SPC24 Antibody [NBP2-47264] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.
Immunocytochemistry/ Immunofluorescence: SPC24 Antibody [NBP2-47264] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Immunohistochemistry: SPC24 Antibody [NBP2-47264] - Staining of human testis shows moderate nuclear positivity in cells in subset of cells in seminiferus ducts.
Immunocytochemistry/ Immunofluorescence: SPC24 Antibody [NBP2-47264] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

SPC24 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: ERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLV
Specificity of human SPC24 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPC24 Protein (NBP2-47264PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SPC24 Antibody

  • FLJ90806
  • hSpc24
  • kinetochore protein Spc24
  • SPBC24
  • SPC24, NDC80 kinetochore complex component, homolog (S. cerevisiae)
  • spindle pole body component 24 homolog (S. cerevisiae)
  • spindle pole body component 24 homolog


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Ha, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ICC, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, MiAr
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SPC24 Antibody (NBP2-47264) (0)

There are no publications for SPC24 Antibody (NBP2-47264).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPC24 Antibody (NBP2-47264) (0)

There are no reviews for SPC24 Antibody (NBP2-47264). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPC24 Antibody (NBP2-47264) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SPC24 Antibody (NBP2-47264)

Discover related pathways, diseases and genes to SPC24 Antibody (NBP2-47264). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPC24 Antibody (NBP2-47264)

Discover more about diseases related to SPC24 Antibody (NBP2-47264).

Pathways for SPC24 Antibody (NBP2-47264)

View related products by pathway.

PTMs for SPC24 Antibody (NBP2-47264)

Learn more about PTMs related to SPC24 Antibody (NBP2-47264).

Blogs on SPC24

There are no specific blogs for SPC24, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SPC24 Antibody and receive a gift card or discount.


Gene Symbol SPC24