NDC80 Antibody (4W2Y2)

Western Blot: NDC80 Antibody (4W2Y2) [NBP3-16121] - Western blot analysis of extracts of various cell lines, using NDC80 Rabbit mAb (NBP3-16121) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

• Reactivity: Hu
• Applications: WB
• Clone: 4W2Y2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

NDC80 Antibody (4W2Y2) Summary

• Description: Novus Biologicals Rabbit NDC80 Antibody (4W2Y2) (NBP3-16121) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 543-642 of human NDC80 (O14777). ESTVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: NDC80
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NDC80 Antibody (4W2Y2)

• HEC1KNTC2
• HECRetinoblastoma-associated protein HEC
• Highly expressed in cancer protein
• highly expressed in cancer, rich in leucine heptad repeats (yeast)
• highly expressed in cancer, rich in leucine heptad repeats
• hsHec1
• hsNDC80
• kinetochore associated 2
• Kinetochore protein Hec1
• kinetochore protein NDC80 homolog
• Kinetochore-associated protein 2
• NDC80 homolog, kinetochore complex component (S. cerevisiae)
• TID3

Background

Human HEC1 is a coiled-coil protein that has been demonstrated to have a role in M-phase progression. It is essential for proper chromosome segregation. Its depletion results in the impairment of chromosome congression and results in spindle checkpoint activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDC80