Nbs1 Recombinant Protein Antigen

Images

 
There are currently no images for Nbs1 Recombinant Protein Antigen (NBP2-54661PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Nbs1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Nbs1

Source: E.coli

Amino Acid Sequence: DTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NBN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-54661. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Nbs1 Recombinant Protein Antigen

  • ATV
  • AT-V1
  • AT-V2
  • Cell cycle regulatory protein p95
  • FLJ10155
  • MGC87362
  • NBN
  • Nbs1
  • NBS1P95
  • NBSNijmegen breakage syndrome protein 1
  • Nibrin
  • Nijmegen breakage syndrome 1 (nibrin)
  • p95 protein of the MRE11/RAD50 complex
  • p95

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1768
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, KO
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-395
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-54661PEP
Species: Hu
Applications: AC

Publications for Nbs1 Recombinant Protein Antigen (NBP2-54661PEP) (0)

There are no publications for Nbs1 Recombinant Protein Antigen (NBP2-54661PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nbs1 Recombinant Protein Antigen (NBP2-54661PEP) (0)

There are no reviews for Nbs1 Recombinant Protein Antigen (NBP2-54661PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Nbs1 Recombinant Protein Antigen (NBP2-54661PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Nbs1 Recombinant Protein Antigen (NBP2-54661PEP)

Discover related pathways, diseases and genes to Nbs1 Recombinant Protein Antigen (NBP2-54661PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nbs1 Recombinant Protein Antigen (NBP2-54661PEP)

Discover more about diseases related to Nbs1 Recombinant Protein Antigen (NBP2-54661PEP).
 

Pathways for Nbs1 Recombinant Protein Antigen (NBP2-54661PEP)

View related products by pathway.

PTMs for Nbs1 Recombinant Protein Antigen (NBP2-54661PEP)

Learn more about PTMs related to Nbs1 Recombinant Protein Antigen (NBP2-54661PEP).
 

Research Areas for Nbs1 Recombinant Protein Antigen (NBP2-54661PEP)

Find related products by research area.

Blogs on Nbs1.

The MRE11 Complex and DNA Damage Response
The maintenance of genome stability depends on the DNA damage response (DDR) which is a complex signaling network including cell cycle checkpoints, DNA repair and damage tolerance pathways. The DDR complex has the ability to sense DNA damage and tra...  Read full blog post.

NBS1: The DNA Repair Trigger
NBS1 (Nijmegen breakage syndrome protein 1) is a component of the MRN complex (Mre11-Rad50-Nbs1) that plays important role in detecting DNA double strand breaks (DSBs) and triggering the downstream cascade. DSBs can be caused by ionizing radiation, ch...  Read full blog post.

NBS1: DNA Repair Trigger
NBS1 (Nijmegen breakage syndrome protein 1) is a component of the MRN complex (Mre11-Rad50-Nbs1) that plays important role in detecting DNA double strand breaks (DSBs) and triggering the downstream cascade. DSBs can be caused by ionizing radiation, ch...  Read full blog post.

Customers Who Bought This Also Bought

Nbs1 Blocking Peptide
NBP1-06705PEP
53BP1 Antibody
NB100-304
Nbs1 Antibody
NB100-143
Mre11 Antibody
NB100-142

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nbs1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NBN
Entrez