MYH6 Antibody

Images

 
Immunohistochemistry-Paraffin: MYH6 Antibody [NBP1-88120] - Myosin Heavy Chain Antibody [NBP1-88120] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in a subset of myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MYH6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYH6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MYH6 Protein (NBP1-88120PEP)
Publications
Read Publications using NBP1-88120.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 17626279)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MYH6 Antibody

  • alpha-MHC
  • ASD3
  • cardiomyopathy
  • CMD1EE
  • CMH14
  • Hypertrophic 1
  • MYH6
  • MYHC
  • MYHCA
  • MyHC-Alpha
  • Myosin Heavy Chain 6
  • Myosin Heavy Chain, Cardiac Muscle Alpha Isoform
  • Myosin, Heavy Chain 6, Cardiac Muscle, Alpha
  • Myosin, Heavy Polypeptide 6, Cardiac Muscle, Alpha (Cardiomyopathy, Hypertrophic 1)
  • Myosin-6
  • SSS3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-52737
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-65675
Species: Hu, Rt, Rb
Applications: ELISA, ICC/IF, IHC, IHC-P
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
H00004622-R01
Species: Hu
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
NBP1-57681
Species: Hu
Applications: WB
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-88120
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for MYH6 Antibody (NBP1-88120)(2)

Reviews for MYH6 Antibody (NBP1-88120) (0)

There are no reviews for MYH6 Antibody (NBP1-88120). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MYH6 Antibody (NBP1-88120) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYH6 Products

MYH6 NBP1-88120

Bioinformatics Tool for MYH6 Antibody (NBP1-88120)

Discover related pathways, diseases and genes to MYH6 Antibody (NBP1-88120). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYH6 Antibody (NBP1-88120)

Discover more about diseases related to MYH6 Antibody (NBP1-88120).
 

Pathways for MYH6 Antibody (NBP1-88120)

View related products by pathway.

PTMs for MYH6 Antibody (NBP1-88120)

Learn more about PTMs related to MYH6 Antibody (NBP1-88120).

Blogs on MYH6

There are no specific blogs for MYH6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYH6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYH6
Entrez