We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Myosin Heavy Chain 1 Antibody - BSA Free

Images

 
Western Blot: Myosin Heavy Chain 1 Antibody [NBP2-95223] - Analysis of extracts of various cell lines, using MYH1 antibody at 1:410 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10038 ...read more
Western Blot: Myosin Heavy Chain 1 Antibody [NBP2-95223] -analysis of lysates from Mouse skeletal muscle using MYH1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 ...read more
Immunohistochemistry-Paraffin: Myosin Heavy Chain 1 Antibody [NBP2-95223] - Human skeletal muscle using MYH1 Rabbit pAb at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer ...read more
Immunocytochemistry/ Immunofluorescence: Myosin Heavy Chain 1 Antibody - Azide and BSA Free [Myosin Heavy Chain 1] - Immunofluorescence analysis of paraffin-embedded mouse heart using Myosin Heavy Chain 1 Rabbit pAb at ...read more
Immunocytochemistry/ Immunofluorescence: Myosin Heavy Chain 1 Antibody - Azide and BSA Free [Myosin Heavy Chain 1] - Immunofluorescence analysis of paraffin-embedded Human heart using Myosin Heavy Chain 1 Rabbit pAb at ...read more
Immunocytochemistry/ Immunofluorescence: Myosin Heavy Chain 1 Antibody - Azide and BSA Free [Myosin Heavy Chain 1] - Immunofluorescence analysis of paraffin-embedded rat heart using Myosin Heavy Chain 1 Rabbit pAb at ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Myosin Heavy Chain 1 Antibody - BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MYH1 (NP_005954.3). MSSDSEMAIFGEAAPFLRKSERERIEAQNKPFDAKTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPKYDKIEDMAMMTHLHEP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYH1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA Recommended starting concentration is 1 μg/mL
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:100 - 1:500
Theoretical MW
223 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Myosin Heavy Chain 1 Antibody - BSA Free

  • DFNA4
  • FLJ13881
  • FLJ43092
  • KIAA2034DKFZp667A1311
  • MHC16
  • MYH1
  • MYH14 variant protein
  • MYH17
  • MyHC-2x
  • MyHC-IIx/d
  • Myosin Heavy Chain 1
  • Myosin heavy chain 14
  • Myosin heavy chain, non-muscle IIc
  • myosin
  • myosin, heavy chain 14
  • myosin, heavy chain 14, non-muscle
  • myosin, heavy polypeptide 14
  • myosin-14
  • NMHC II-C
  • NMHC-II-C
  • Non-muscle myosin heavy chain IIc
  • nonmuscle myosin heavy chain II-C

Background

The Myosin family includes a number of ATP-driven motor proteins involved in muscle contration and actin-dependent cellular motility. Although they were originally thought to be limited to muscle tissues, new genes sharing basic myosin superfamily properties have since been identifed nearly all eukaryotic cell types. The myosin proteins are spearated into 18 different classes, which have been found to be highly conserved across species. Myosin antibodies are commonly used for cell motility, ATP hydrolysis and muscle studies, as well as loading controls.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-05634
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-94624
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
MAB66861
Species: Hu
Applications: ICC, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, WB
NBP1-89707
Species: Hu
Applications: IHC,  IHC-P
NBP2-94079
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
MAB4470
Species: All-Multi
Applications: Flow, ICC, IHC, WB
NBP2-41309
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-44245
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NB500-181
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
MAB8979
Species: Hu
Applications: ICC, IHC, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
H00001760-P01
Species: Hu
Applications: ELISA, AP, PA, WB
788-G8/CF
Species: Hu, Mu, Rt
Applications: BA
NBP1-52030
Species: Hu
Applications: PEP-ELISA, WB

Publications for Myosin Heavy Chain 1 Antibody (NBP2-95223) (0)

There are no publications for Myosin Heavy Chain 1 Antibody (NBP2-95223).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin Heavy Chain 1 Antibody (NBP2-95223) (0)

There are no reviews for Myosin Heavy Chain 1 Antibody (NBP2-95223). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Myosin Heavy Chain 1 Antibody (NBP2-95223) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myosin Heavy Chain 1 Products

Research Areas for Myosin Heavy Chain 1 Antibody (NBP2-95223)

Find related products by research area.

Blogs on Myosin Heavy Chain 1

There are no specific blogs for Myosin Heavy Chain 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myosin Heavy Chain 1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol MYH1