MYH4 Antibody Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1450-1550 of human MYH4 (NP_060003.2). QRNFDKVLAEWKQKYEETQAELEASQKESRSLSTELFKVKNAYEESLDHLETLKRENKNLQQEISDLTEQIAEGGKHIHELEKVKKQLDHEKSELQTSLEE |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MYH4 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 1:50-1:200
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 1:100 - 1:500
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS with 50% glycerol, pH7.3. |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for MYH4 Antibody
Background
MYH4, also known as Myosin-4, is a 1939 amino acid protein that is 223 kDa, predominantly found in myocytes mediates plus-ended movement along microfilaments and involved in muscle contraction through cyclic interactions with actin-rich thin filaments, creating a contractile force. It is regulated by phosphorylation via myosin light chain kinase (MLCK) and by intracellular Ca2+ concentrations. Current research is being performed on several diseases and disorders including congestive heart failure, yaws, myocarditis, hermaphroditism, liver disease, pharyngitis, and alcoholism. This protein is involved in cell adhesion integrin-mediated cell adhesion and migration, cell adhesion tight junctions, cytoskeleton remodeling regulation of actin cytoskeleton by Rho GTPases, immune response CCR3 signaling in eosinophils, development MAG-dependent inhibition of neurite outgrowth, RhoA, antioxidant action of vitamin-C, transendothelial migration of leukocytes, actin nucleation by ARP-WASP complex, epithelial adherens junctions, inhibitory action of lipoxins on neutrophil migration, membrane trafficking, translocation of GLUT4 to the plasma membrane, translocation of GLUT4 vesicle and docking at the plasma membrane, and Viral myocarditis pathways forming interactions with ESR2, NTHL1, S100A4, USP15, C12orf44, CNBP, ACTB, and over 30 other proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: All-Multi
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ELISA
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Ch, Hu, Mu, Rt
Applications: ICC, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Publications for MYH4 Antibody (NBP3-05634) (0)
There are no publications for MYH4 Antibody (NBP3-05634).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MYH4 Antibody (NBP3-05634) (0)
There are no reviews for MYH4 Antibody (NBP3-05634).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MYH4 Antibody (NBP3-05634) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MYH4 Products
Bioinformatics Tool for MYH4 Antibody (NBP3-05634)
Discover related pathways, diseases and genes to MYH4 Antibody (NBP3-05634). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for MYH4 Antibody (NBP3-05634)
Discover more about diseases related to MYH4 Antibody (NBP3-05634).
| | Pathways for MYH4 Antibody (NBP3-05634)
View related products by pathway.
|
PTMs for MYH4 Antibody (NBP3-05634)
Learn more about PTMs related to MYH4 Antibody (NBP3-05634).
| | Research Areas for MYH4 Antibody (NBP3-05634)
Find related products by research area.
|
Blogs on MYH4