MYH4 Antibody

Western Blot: MYH4 Antibody [NBP3-05634] - Western blot analysis of extracts of C2C12 cells, using MYH4 antibody (NBP3-05634) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.

Immunohistochemistry: MYH4 Antibody [NBP3-05634] - Immunofluorescence analysis of mouse skeletal muscle using MYH4 antibody (NBP3-05634) at dilution of 1:100. Blue: DAPI for nuclear staining.

Western Blot: MYH4 Antibody [NBP3-05634] - Western blot analysis of extracts of Rat skeletal muscle, using MYH4 antibody (NBP3-05634) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunohistochemistry-Paraffin: MYH4 Antibody [NBP3-05634] - Mouse heart using MYH4 antibody at dilution of 1:150 (40x lens).

Immunohistochemistry-Paraffin: MYH4 Antibody [NBP3-05634] - Mouse skeletal muscle using MYH4 antibody at dilution of 1:150 (40x lens).

Immunohistochemistry-Paraffin: MYH4 Antibody [NBP3-05634] - Rat heart using MYH4 antibody at dilution of 1:150 (40x lens).

Immunohistochemistry-Paraffin: MYH4 Antibody [NBP3-05634] - Rat skeletal muscle using MYH4 antibody at dilution of 1:150 (40x lens).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MYH4 Antibody Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1450-1550 of human MYH4 (NP_060003.2). QRNFDKVLAEWKQKYEETQAELEASQKESRSLSTELFKVKNAYEESLDHLETLKRENKNLQQEISDLTEQIAEGGKHIHELEKVKKQLDHEKSELQTSLEE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYH4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1:50-1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:100 - 1:500

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS with 50% glycerol, pH7.3.
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MYH4 Antibody

• MYH4
• MyHC-2b
• MyHC-IIb
• myosin heavy chain 4
• myosin heavy chain IIb
• myosin heavy chain, skeletal muscle, fetal
• myosin, heavy chain 4, skeletal muscle
• myosin, heavy polypeptide 4, skeletal muscle
• myosin-4

Background

MYH4, also known as Myosin-4, is a 1939 amino acid protein that is 223 kDa, predominantly found in myocytes mediates plus-ended movement along microfilaments and involved in muscle contraction through cyclic interactions with actin-rich thin filaments, creating a contractile force. It is regulated by phosphorylation via myosin light chain kinase (MLCK) and by intracellular Ca2+ concentrations. Current research is being performed on several diseases and disorders including congestive heart failure, yaws, myocarditis, hermaphroditism, liver disease, pharyngitis, and alcoholism. This protein is involved in cell adhesion integrin-mediated cell adhesion and migration, cell adhesion tight junctions, cytoskeleton remodeling regulation of actin cytoskeleton by Rho GTPases, immune response CCR3 signaling in eosinophils, development MAG-dependent inhibition of neurite outgrowth, RhoA, antioxidant action of vitamin-C, transendothelial migration of leukocytes, actin nucleation by ARP-WASP complex, epithelial adherens junctions, inhibitory action of lipoxins on neutrophil migration, membrane trafficking, translocation of GLUT4 to the plasma membrane, translocation of GLUT4 vesicle and docking at the plasma membrane, and Viral myocarditis pathways forming interactions with ESR2, NTHL1, S100A4, USP15, C12orf44, CNBP, ACTB, and over 30 other proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYH4