Myeloperoxidase/MPO Antibody - BSA Free

Immunohistochemistry: Myeloperoxidase/MPO Antibody [NBP1-87556] - Staining of human spleen shows strong cytoplasmic positivity in subset of cells in red pulp .

Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP1-87556] - Staining of human cerebral cortex shows low expression as expected.

Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP1-87556] - Staining of human bone marrow shows high expression.

Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP1-87556] - Staining of human liver.

Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP1-87556] - Staining of human testis.

Immunohistochemistry-Paraffin: Myeloperoxidase/MPO Antibody [NBP1-87556] - Analysis in human bone marrow and cerebral cortex tissues using NBP1-87556 antibody. Corresponding Myeloperoxidase/MPO RNA-seq data are presented for the same tissues.

Staining of human bone marrow, cerebral cortex, liver and testis using NBP1-87556 (A) shows similar protein distribution across tissues to independent antibody NBP2-38922 (B).

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Myeloperoxidase/MPO Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Myeloperoxidase/MPO Antibody - BSA Free (NBP1-87556) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MPO
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Myeloperoxidase/MPO Protein (NBP1-87556PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Myeloperoxidase/MPO Antibody - BSA Free

• EC 1.11.1
• EC 1.11.1.7
• MPO
• Myeloperoxidase

Background

FUNCTION: Part of the host defense system of polymorphonuclear leukocytes. It is responsible for microbicidal activity against a wide range of organisms. In the stimulated PMN, MPO catalyzes the production of hypohalous acids, primarily hypochlorous acid in physiologic situations, and other toxic intermediates that greatly enhance PMN microbicidal activity. MPO is an important marker for myeloid cells, from the promyelocyte stage and to the mature forms. CATALYTIC ACTIVITY: Donor + H2O2 = oxidized donor + 2 H2O. CATALYTIC ACTIVITY: Cl- + H2O2 = HOCl + 2 H2O. COFACTOR: Binds 1 calcium ion per heterodimer. COFACTOR: Binds 1 heme B (iron-protoporphyrin IX) group covalently per heterodimer. SUBUNIT: Tetramer of two light chains and two heavy chains. SUBCELLULAR LOCATION: Lysosome. ALTERNATIVE PRODUCTS: 3 named isoforms produced by alternative splicing. DISEASE: Defects in MPO are the cause of myeloperoxidase deficiency (MPD). MPD is an autosomal recessive defect that results in disseminated candidiasis. SIMILARITY: Belongs to the peroxidase family. XPO subfamily.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MPO