Recombinant Human MyD88 GST (N-Term) Protein

SDS-Page: Recombinant Human MyD88 Protein [H00004615-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue

Product Discontinued

Recombinant Human MyD88 GST (N-Term) Protein Summary

• Description: Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-296 of Human MYD88
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRSITVCDYTNPCTKSWFWTRLAKALSLP

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: MYD88
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Immunoprecipitation
  • Protein Array
  • Western Blot
• Application Notes: Use in immunprecipitation reported in scientific literature (PMID 25808990)
• Theoretical MW: 58.3 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MyD88 GST (N-Term) Protein

• MyD88
• MYD88D
• myeloid differentiation primary response gene (88)
• myeloid differentiation primary response protein MyD88

Background

Myeloid differentiation Marker 88 (MyD88) is a universal adaptor molecule for the Toll/IL1R and is involved in the inflammatory response induced by IL1, IL18 and LPS. MyD88 associates with and recruits IRAK to IL1 receptor complex in response to IL1. This pathway further leads to activation of NFkB. Targeted disruption of the MyD88 gene results in lose of cellular responses to IL1 and IL18, and MyD88 deficient mice lack responses to bacterial product LPS that employs Toll like receptors 2 and 4 as the signaling receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for MyD88 Recombinant Protein (H00004615-P01)(1)

Publication using H00004615-P01

• Mellett M, Atzei P, Bergin R et al. Orphan receptor IL-17RD regulates Toll-like receptor signalling via SEFIR/TIR interactions. Nat Commun. 2015-03-26 [PMID: 25808990] (IP, Human)

Bioinformatics

• Gene Symbol: MYD88