MYBPC1 Antibody - BSA Free

Immunohistochemistry-Paraffin: MYBPC1 Antibody [NBP1-86385] - Staining of human lymph node.

Immunohistochemistry-Paraffin: MYBPC1 Antibody [NBP1-86385] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: MYBPC1 Antibody [NBP1-86385] - Staining of human skeletal muscle shows high expression.

Immunohistochemistry-Paraffin: MYBPC1 Antibody [NBP1-86385] - Staining in human skeletal muscle and liver tissues using anti-MYBPC1 antibody. Corresponding MYBPC1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MYBPC1 Antibody [NBP1-86385] - Staining of human kidney, liver, lymph node and skeletal muscle using Anti-MYBPC1 antibody NBP1-86385 (A) shows similar protein distribution across tissues to independent antibody NBP1-86427 (B).

Immunohistochemistry-Paraffin: MYBPC1 Antibody [NBP1-86385] - Staining of human kidney.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MYBPC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MYBPC1 Antibody - BSA Free (NBP1-86385) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAIT
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYBPC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MYBPC1 Protein (NBP1-86385PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MYBPC1 Antibody - BSA Free

• C-protein, skeletal muscle slow isoform
• MYBPCC
• MYBPCS
• myosin binding protein C, slow type
• myosin-binding protein C, slow-type
• skeletal muscle C-protein
• Slow MyBP-C
• slow-type

Background

MYBPC1, also known as Myosin-binding protein C, slow-type, is a protein with 10 isoforms ranging from a 1,120 amino acid isoform that is 126 kDa to a 1,173 amino acid isoform that is 131 kDa, located in the crossbridge region of vertebrate striated muscle a bands, plays an important role in muscle contraction by recruiting muscle-type creatine kinase to myosin filaments and modifies the activity of actin-activated myosin ATPase. Studies are being performed on the relationship of this protein to distal arthrogryposis, urethral intrinsic sphincter deficiency, akinetic mutism, hypertrophic cardiomyopathy, familial hypertrophic cardiomyopathy, dilated cardiomyopathy, dysgraphia, laryngeal squamous cell carcinoma, fg syndrome, atrial fibrillation, squamous cell carcinoma, mutism, muscular dystrophy, urethritis, polymyositis, laryngitis, dermatomyositis, myositis, distal arthrogryposis, and urethral intrinsic sphincter deficiency. MYBPC1 protein involvement has been observed with relation to CALM1, CALM2, CALM3, FHL1, MYBPC2, USP25, TTN, DYSF, ACTN2, and more than 30 other proteins in the muscle contraction and striated muscle contraction pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYBPC1
• Entrez:
  • 4604(Human)
• Uniprot:
  • Q00872(Human)