MYBPC1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit MYBPC1 Antibody - BSA Free (NBP1-86385) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: YYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAIT |
| Predicted Species |
Mouse (96%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MYBPC1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MYBPC1 Antibody - BSA Free
Background
MYBPC1, also known as Myosin-binding protein C, slow-type, is a protein with 10 isoforms ranging from a 1,120 amino acid isoform that is 126 kDa to a 1,173 amino acid isoform that is 131 kDa, located in the crossbridge region of vertebrate striated muscle a bands, plays an important role in muscle contraction by recruiting muscle-type creatine kinase to myosin filaments and modifies the activity of actin-activated myosin ATPase. Studies are being performed on the relationship of this protein to distal arthrogryposis, urethral intrinsic sphincter deficiency, akinetic mutism, hypertrophic cardiomyopathy, familial hypertrophic cardiomyopathy, dilated cardiomyopathy, dysgraphia, laryngeal squamous cell carcinoma, fg syndrome, atrial fibrillation, squamous cell carcinoma, mutism, muscular dystrophy, urethritis, polymyositis, laryngitis, dermatomyositis, myositis, distal arthrogryposis, and urethral intrinsic sphincter deficiency. MYBPC1 protein involvement has been observed with relation to CALM1, CALM2, CALM3, FHL1, MYBPC2, USP25, TTN, DYSF, ACTN2, and more than 30 other proteins in the muscle contraction and striated muscle contraction pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: All-Multi
Applications: Flow, ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt
Applications: PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Publications for MYBPC1 Antibody (NBP1-86385) (0)
There are no publications for MYBPC1 Antibody (NBP1-86385).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MYBPC1 Antibody (NBP1-86385) (0)
There are no reviews for MYBPC1 Antibody (NBP1-86385).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for MYBPC1 Antibody (NBP1-86385) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MYBPC1 Products
Blogs on MYBPC1