| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Myosin Heavy Chain 3 Antibody - BSA Free (NBP1-89707) is a polyclonal antibody validated for use in IHC. Anti-Myosin Heavy Chain 3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAML |
| Predicted Species | Mouse (96%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MYH3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-89707 | Applications | Species |
|---|---|---|
| Muro S, Akita K Novel combination method of wide-range serial sectioning and 3D reconstruction visualizing both macro-level dynamics and micro-level interactions in an attempt to analyze the female pelvic floor Anatomical science international 2023-03-07 [PMID: 36882587] (Immunohistochemistry-Paraffin) | Immunohistochemistry-Paraffin |
Secondary Antibodies |
Isotype Controls |
Research Areas for Myosin Heavy Chain 3 Antibody (NBP1-89707)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MYH3 |