PDCD4 Antibody

Images

 
Western Blot: PDCD4 Antibody [NBP1-83302] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP1-83302] - Staining of human thyroid gland shows strong nuclear positivity in glandular cells.
Western Blot: PDCD4 Antibody [NBP1-83302] - Analysis in human cell line Daudi.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDCD4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDCD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PDCD4 Protein (NBP1-83302PEP)
Publications
Read Publications using NBP1-83302.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22747440)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDCD4 Antibody

  • H731
  • H731nuclear antigen H731
  • MGC33046
  • MGC33047
  • Neoplastic transformation inhibitor protein
  • Nuclear antigen H731-like
  • PDCD4
  • programmed cell death 4 (neoplastic transformation inhibitor)
  • programmed cell death protein 4
  • Protein 197/15a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
NBP2-24632
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83302
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PDCD4 Antibody (NBP1-83302)(7)

Reviews for PDCD4 Antibody (NBP1-83302) (0)

There are no reviews for PDCD4 Antibody (NBP1-83302). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDCD4 Antibody (NBP1-83302) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDCD4 Products

Bioinformatics Tool for PDCD4 Antibody (NBP1-83302)

Discover related pathways, diseases and genes to PDCD4 Antibody (NBP1-83302). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDCD4 Antibody (NBP1-83302)

Discover more about diseases related to PDCD4 Antibody (NBP1-83302).
 

Pathways for PDCD4 Antibody (NBP1-83302)

View related products by pathway.

PTMs for PDCD4 Antibody (NBP1-83302)

Learn more about PTMs related to PDCD4 Antibody (NBP1-83302).
 

Research Areas for PDCD4 Antibody (NBP1-83302)

Find related products by research area.

Blogs on PDCD4

There are no specific blogs for PDCD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDCD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDCD4
Entrez