UCH-L3 Antibody

Images

 
Western Blot: UCH-L3 Antibody [NBP1-86037] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: UCH-L3 Antibody [NBP1-86037] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: UCH-L3 Antibody [NBP1-86037] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: UCH-L3 Antibody [NBP1-86037] - Staining of human testis shows cytoplasmic positivity in cells of seminiferus ducts.
Immunohistochemistry-Paraffin: UCH-L3 Antibody [NBP1-86037] - Staining of human prostate shows weak to moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: UCH-L3 Antibody [NBP1-86037] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: UCH-L3 Antibody [NBP1-86037] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UCH-L3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISN
Specificity
Specificity of human UCH-L3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UCHL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UCH-L3 Protein (NBP1-86037PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UCH-L3 Antibody

  • EC 3.4.19.12
  • ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
  • ubiquitin carboxyl-terminal hydrolase isozyme L3
  • Ubiquitin Thioesterase L3
  • ubiquitin thiolesterase
  • UCHL3
  • UCH-L3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1160
Species: Hu, Mu, Rt, Po, Bv, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB100-513
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF6278
Species: Hu, Mu
Applications: WB
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, KD
MAB4077
Species: Hu
Applications: WB, IHC
NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00002023-M01
Species: Hu, Fe
Applications: WB, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP
AF5650
Species: Hu
Applications: WB, IHC
H00006045-M01
Species: Hu, Mu, I
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
NBP2-76350
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF

Publications for UCH-L3 Antibody (NBP1-86037) (0)

There are no publications for UCH-L3 Antibody (NBP1-86037).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UCH-L3 Antibody (NBP1-86037) (0)

There are no reviews for UCH-L3 Antibody (NBP1-86037). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UCH-L3 Antibody (NBP1-86037) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UCH-L3 Products

Bioinformatics Tool for UCH-L3 Antibody (NBP1-86037)

Discover related pathways, diseases and genes to UCH-L3 Antibody (NBP1-86037). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UCH-L3 Antibody (NBP1-86037)

Discover more about diseases related to UCH-L3 Antibody (NBP1-86037).
 

Pathways for UCH-L3 Antibody (NBP1-86037)

View related products by pathway.

PTMs for UCH-L3 Antibody (NBP1-86037)

Learn more about PTMs related to UCH-L3 Antibody (NBP1-86037).

Blogs on UCH-L3

There are no specific blogs for UCH-L3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UCH-L3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UCHL3