We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CPT1B Antibody - BSA Free

Images

 
Western Blot: CPT1B Antibody [NBP1-59576] - Sample Type : 1: 45ug human capan1 cell lysate Primary Antibody Dilution : 1:1000 Secondary Antibody : Anti-rabbit HRP Secondary Antibody Dilution : 1:5000 Color
Immunohistochemistry: CPT1B Antibody [NBP1-59576] - searcher: Dr. Pankaj Kumar Singh, UNMC, Omaha, NE Application: IHC Species+tissue/cell type:Species+tissue/cell type: Human Capan1 cells Primary antibody dilution: ...read more
Western Blot: CPT1B Antibody [NBP1-59576] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.
Western Blot: CPT1B Antibody [NBP1-59576] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
The effect of HFD and HFD+FO consumption on mitochondrial channeling of fatty acids. Panel A presents a total acyl-carnitine (A-CAR) content in rat VAT and SAT, respectively. Panel B and D show the content of A-CAR ...read more
The effect of HFD and HFD+FO consumption on mitochondrial channeling of fatty acids. Panel A presents a total acyl-carnitine (A-CAR) content in rat VAT and SAT, respectively. Panel B and D show the content of A-CAR ...read more
CCM treatment regulates the key fatty acid metabolism factors in rabbits with HF. (a) Western blot analysis of the expressions of CD36, CPT-1, and ADAM. Densitometric analysis is shown in the bar graph. (b) Western blot ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

CPT1B Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to CPT1B(carnitine palmitoyltransferase 1B (muscle)) The peptide sequence was selected from the middle region of CPT1B. Peptide sequence DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPT1B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:300
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
Theoretical MW
88 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-59576 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 31013835).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for CPT1B Antibody - BSA Free

  • carnitine O-palmitoyltransferase 1, muscle isoform
  • carnitine O-palmitoyltransferase I, mitochondrial muscle isoform
  • Carnitine O-palmitoyltransferase I, muscle isoform
  • carnitine palmitoyltransferase 1B (muscle)
  • Carnitine palmitoyltransferase 1B
  • Carnitine palmitoyltransferase I-like protein
  • CPT I
  • CPT1B
  • CPT1M
  • CPT1-M
  • CPT1-MMCCPT1
  • CPTI
  • CPTI-M
  • EC 2.3.1
  • EC 2.3.1.21
  • FLJ55729
  • FLJ58750
  • KIAA1670
  • MCPT1
  • M-CPT1

Background

The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-53791
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-85471
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-92299
Species: Hu
Applications: WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
MAB4099
Species: Hu
Applications: ELISA, IP, WB
MAB6898
Species: Hu, Mu
Applications: WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
409-ML
Species: Mu
Applications: BA
NB400-144
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-86616
Species: Hu
Applications: IHC,  IHC-P, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP1-87964
Species: Hu
Applications: IHC,  IHC-P
NBP1-90274
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-04676
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB

Publications for CPT1B Antibody (NBP1-59576)(6)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 2 applications: WB, Western Blot.


Filter By Application
WB
(3)
Western Blot
(2)
All Applications
Filter By Species
Human
(3)
Mouse
(2)
Rat
(1)
All Species
Showing Publications 1 - 6 of 6.
Publications using NBP1-59576 Applications Species
de Souza SLB, Mota GAF, da Silva VL et al. Effects of early exercise on cardiac function and lipid metabolism pathway in heart failure J Cell Mol Med 2023-08-31 [PMID: 37654004] (Western Blot, Human) Western Blot Human
Zhang F, Liu L, Xie Y et al. Cardiac contractility modulation ameliorates myocardial metabolic remodeling in a rabbit model of chronic heart failure through activation of AMPK and PPAR-? pathway Open Med (Wars) 2022-02-22 [PMID: 35799598] (Western Blot, Human) Western Blot Human
Pellegrin M, BouzourEne K, Aubert JF et al. Impact of aerobic exercise type on blood flow, muscle energy metabolism, and mitochondrial biogenesis in experimental lower extremity artery disease Sci Rep 2020-08-20 [PMID: 32820213] (WB, Mouse) WB Mouse
Chacinska, M;Zabielski, P;Ksiazek, M;Szataj, P;Jarzabek, K;Kojta, I;Chabowski, A;Btachnio-Zabielska, AU; The Impact of OMEGA-3 Fatty Acids Supplementation on Insulin Resistance and Content of Adipocytokines and Biologically Active Lipids in Adipose Tissue of High-Fat Diet Fed Rats Nutrients 2019-04-12 [PMID: 31013835] (WB, Rat) WB Rat
de Toledo Frias F, Rocha KCE, de Mendonca M et al. Fenofibrate Reverses Changes Induced By High-Fat Diet On Metabolism In Mice Muscle And Visceral Adipocytes J. Cell. Physiol. 2017-09-19 [PMID: 28926107] (Mouse) Mouse
Brittain EL, Talati M, Fessel JP et al. Fatty Acid Metabolic Defects and Right Ventricular Lipotoxicity in Human Pulmonary Arterial Hypertension. Circulation 2016-05-17 [PMID: 27006481] (WB, Human)

Details:
The Novus CPT1B antibody was used in western blotting of human tissue homogenates
WB Human

Reviews for CPT1B Antibody (NBP1-59576) (0)

There are no reviews for CPT1B Antibody (NBP1-59576). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPT1B Antibody (NBP1-59576) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CPT1B Products

Research Areas for CPT1B Antibody (NBP1-59576)

Find related products by research area.

Blogs on CPT1B

There are no specific blogs for CPT1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPT1B Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CPT1B
Entrez
Uniprot