CPT1B Antibody


Western Blot: CPT1B Antibody [NBP1-59576] - Sample Type : 1: 45ug human capan1 cell lysate Primary Antibody Dilution : 1:1000 Secondary Antibody : Anti-rabbit HRP Secondary Antibody Dilution : 1:5000 Color
Immunohistochemistry: CPT1B Antibody [NBP1-59576] - searcher: Dr. Pankaj Kumar Singh, UNMC, Omaha, NE Application: IHC Species+tissue/cell type:Species+tissue/cell type: Human Capan1 cells Primary antibody dilution: ...read more
Western Blot: CPT1B Antibody [NBP1-59576] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.
Western Blot: CPT1B Antibody [NBP1-59576] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, IHC

Order Details

CPT1B Antibody Summary

Synthetic peptides corresponding to CPT1B(carnitine palmitoyltransferase 1B (muscle)) The peptide sequence was selected from the middle region of CPT1B. Peptide sequence DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:300
Application Notes
This is a rabbit polyclonal antibody against CPT1B and was validated on Western blot.
Theoretical MW
88 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publications using
NBP1-59576 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28926107).

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CPT1B Antibody

  • carnitine O-palmitoyltransferase 1, muscle isoform
  • carnitine O-palmitoyltransferase I, mitochondrial muscle isoform
  • Carnitine O-palmitoyltransferase I, muscle isoform
  • carnitine palmitoyltransferase 1B (muscle)
  • Carnitine palmitoyltransferase 1B
  • Carnitine palmitoyltransferase I-like protein
  • CPT I
  • CPT1M
  • CPTI
  • CPTI-M
  • EC 2.3.1
  • EC
  • FLJ55729
  • FLJ58750
  • KIAA1670
  • MCPT1
  • M-CPT1


The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Mu
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ha, Sq
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC

Publications for CPT1B Antibody (NBP1-59576)(2)

Reviews for CPT1B Antibody (NBP1-59576) (0)

There are no reviews for CPT1B Antibody (NBP1-59576). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPT1B Antibody (NBP1-59576) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CPT1B Antibody (NBP1-59576)

Discover related pathways, diseases and genes to CPT1B Antibody (NBP1-59576). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPT1B Antibody (NBP1-59576)

Discover more about diseases related to CPT1B Antibody (NBP1-59576).

Pathways for CPT1B Antibody (NBP1-59576)

View related products by pathway.

PTMs for CPT1B Antibody (NBP1-59576)

Learn more about PTMs related to CPT1B Antibody (NBP1-59576).

Research Areas for CPT1B Antibody (NBP1-59576)

Find related products by research area.

Blogs on CPT1B

There are no specific blogs for CPT1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CPT1B Antibody and receive a gift card or discount.


Gene Symbol CPT1B