ATRX Antibody

Images

 
Western Blot: ATRX Antibody [NBP1-83077] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ATRX antibody. Remaining relative intensity is presented. Loading ...read more
Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Immunohistochemical staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.
Western Blot: ATRX Antibody [NBP1-83077] - Analysis in human cell line A-549.
Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons and glial cells.
Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Immunohistochemical staining of human glioma shows moderate to strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in a subset of cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATRX Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATRX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATRX Protein (NBP1-83077PEP)
Publications
Read Publications using
NBP1-83077 in the following applications:

  • IHC
    7 publications
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 22869205).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATRX Antibody

  • alpha thalassemia/mental retardation syndrome X-linked (RAD54 (S. cerevisiae)homolog)
  • alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S.cerevisiae)
  • alpha thalassemia/mental retardation syndrome X-linked
  • ATP-dependent helicase ATRX
  • ATR2
  • DNA dependent ATPase and helicase
  • EC 3.6.1
  • EC 3.6.4.12
  • helicase 2, X-linked
  • Juberg-Marsidi syndrome
  • MGC2094
  • MRXHF1
  • RAD54 homolog
  • RAD54L
  • SFM1
  • SHS
  • transcriptional regulator ATRX
  • XH2RAD54
  • X-linked helicase II
  • X-linked nuclear protein
  • XNPZNF-HX
  • Zinc finger helicase
  • Znf-HX

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-58116
Species: Hu
Applications: ICC/IF
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-04611
Species: Hu
MAB2476
Species: Hu
Applications: WB, IHC
NBP1-85309
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-181
Species: Hu, Mu
Applications: WB, IP
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83077
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ATRX Antibody (NBP1-83077)(16)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(7)
WB
(1)
All Applications
Filter By Species
Human
(8)
All Species
Showing Publications 1 - 10 of 16. Show All 16 Publications.
Publications using NBP1-83077 Applications Species
Masayuki Yoshida, Reiko Ogawa, Hiroshi Yoshida et al. TERT promoter mutations are frequent and show association with MED12 mutations in phyllodes tumors of the breast. British Journal of Cancer 2015 Sep 10 [PMID: 26355235] (IHC, Human) IHC Human
Napier CE, Huschtscha LI, Harvey A et al. ATRX represses alternative lengthening of telomeres. Oncotarget 2015 Jun 30 [PMID: 26001292] (WB, Human) WB Human
Hayashi S, Sasaki H, Kimura T et al. Molecular-genetic and clinical characteristics of gliomas with astrocytic appearance and total 1p19q loss in a single institutional consecutive cohort. Oncotarget 2015 Jun 30 [PMID: 25991674] (IHC, Human) IHC Human
Fishbein L, Khare S, Wubbenhorst B et al. Whole exome sequencing identifies somatic ATRX mutations in pheochromocytomas and paragangliomas. Nat Commun 2015 Jan 21 [PMID: 25608029] (IHC, Human) IHC Human
Cryan JB, Haidar S, Ramkissoon LA et al. Clinical multiplexed exome sequencing distinguishes adult oligodendroglial neoplasms from astrocytic and mixed lineage gliomas. Oncotarget 2014 Sep 30 [PMID: 25257301] (IHC, Human) IHC Human
Barszczyk M, Buczkowicz P, Castelo-Branco P et al. Telomerase inhibition abolishes the tumorigenicity of pediatric ependymoma tumor-initiating cells. Acta Neuropathol 2014 Dec [PMID: 25120190] (IHC, Human) IHC Human
Haberler C, Wohrer A. Clinical Neuropathology practice news 2-2014: ATRX, a new candidate biomarker in gliomas. Clin Neuropathol 2014 Mar-Apr [PMID: 24559763]
Cairncross JG, Wang M, Jenkins RB et al. Benefit From Procarbazine, Lomustine, and Vincristine in Oligodendroglial Tumors Is Associated With Mutation of IDH. J Clin Oncol 2014 Mar 10 [PMID: 24516018] (IHC, Human) IHC Human
Abedalthagafi M, Phillips JJ, Kim GE et al. The alternative lengthening of telomere phenotype is significantly associated with loss of ATRX expression in high-grade pediatric and adult astrocytomas: a multi-institutional study of 214 astrocytomas. Mod Pathol 2013 Nov [PMID: 23765250]
Nguyen DN, Heaphy CM, de Wilde RF et al. Molecular and morphologic correlates of the alternative lengthening of telomeres phenotype in high-grade astrocytomas. Brain Pathol 2013 May [PMID: 22928601]
Show All 16 Publications.

Reviews for ATRX Antibody (NBP1-83077) (0)

There are no reviews for ATRX Antibody (NBP1-83077). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATRX Antibody (NBP1-83077) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATRX Products

Bioinformatics Tool for ATRX Antibody (NBP1-83077)

Discover related pathways, diseases and genes to ATRX Antibody (NBP1-83077). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATRX Antibody (NBP1-83077)

Discover more about diseases related to ATRX Antibody (NBP1-83077).
 

Pathways for ATRX Antibody (NBP1-83077)

View related products by pathway.

PTMs for ATRX Antibody (NBP1-83077)

Learn more about PTMs related to ATRX Antibody (NBP1-83077).
 

Research Areas for ATRX Antibody (NBP1-83077)

Find related products by research area.

Blogs on ATRX

There are no specific blogs for ATRX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATRX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATRX