Orthogonal Strategies: Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Staining in human cerebral cortex and liver tissues . Corresponding ATRX RNA-seq data are presented for the same tissues.
Genetic Strategies: Western Blot: ATRX Antibody [NBP1-83077] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-ATRX antibody. Remaining relative intensity ...read more
Immunocytochemistry/ Immunofluorescence: ATRX Antibody [NBP1-83077] - Staining of human cell line A549 shows localization to nucleoplasm and nuclear bodies. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons and glial cells.
Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Staining of human glioma shows moderate to strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Staining of human uterine cervix shows moderate to strong nuclear positivity in squamous epithelial cells.
This antibody was developed against Recombinant Protein corresponding to amino acids: AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRR
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATRX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
ATRX is encoded by this gene contains an ATPase/helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. The mutations of this gene are associated with an X-linked mental retardation (XLMR) syndrome most often accompanied by alpha-thalassemia (ATRX) syndrome. These mutations have been shown to cause diverse changes in the pattern of DNA methylation, which may provide a link between chromatin remodeling, DNA methylation, and gene expression in developmental processes. This protein is found to undergo cell cycle-dependent phosphorylation, which regulates its nuclear matrix and chromatin association, and suggests its involvement in the gene regulation at interphase and chromosomal segregation in mitosis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
ssa Francesca DSMP, Buttarelli R. Biomolecular characterization of metastatic medulloblastoma and study of telomere lengthening control Thesis 2017 (IHC-P, Human)
Bioinformatics Tool for ATRX Antibody (NBP1-83077)
Discover related pathways, diseases and genes to ATRX Antibody (NBP1-83077). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for ATRX Antibody (NBP1-83077)
Discover more about diseases related to ATRX Antibody (NBP1-83077).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our ATRX Antibody and receive a gift card or discount.