Home » Titin » Titin Antibodies » Titin Antibody

Titin Antibody

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: Titin Antibody [NBP1-88071] - SMYD2 Cys13 glutathionylation or oxidation reduces myofibril integrity. Monitoring the myofibril alignment in rat neonatal cardiomyocytes upon incubation of AMA (2 ug/mL) for 12 h: no expression of SMYD2 WT. Immunostainings were done by using antibodies to SMYD2, HA (green), or titin (alpha-titin-NT, red). About 30 cells were photographed and examined for myofibril alignment or directionality by FiberFit software. 34 Images represent the major myofibril structure in individual conditions. Scale bars, 10 um. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-018-06786-x), licensed under a CC-BY licence.
Immunocytochemistry/ Immunofluorescence: Titin Antibody [NBP1-88071] - SMYD2 Cys13 glutathionylation or oxidation reduces myofibril integrity. Monitoring the myofibril alignment in rat neonatal cardiomyocytes upon ...read more
Immunohistochemistry-Paraffin: Titin Antibody [NBP1-88071] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Titin Antibody [NBP1-88071] - Analysis in human skeletal muscle and liver tissues. Corresponding TTN RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Titin Antibody [NBP1-88071] - Staining of human fallopian tube shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Titin Antibody [NBP1-88071] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Titin Antibody [NBP1-88071] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Titin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYT
Specificity
Specificity of human Titin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
HIER pH6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID: 30337525).
Control Peptide
Titin Protein (NBP1-88071PEP)
Publications
Read Publications using
NBP1-88071 in the following applications:

Reactivity Notes

Rat reactivity reported in the scientific literature (PMID: 30337525).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Titin Antibody

  • cardiomyopathy, dilated 1G (autosomal dominant)
  • CMD1G
  • CMH9
  • CMPD4
  • connectin
  • DKFZp451N061
  • EC 2.7.11.1
  • EOMFC
  • FLJ32040
  • FLJ34413
  • FLJ39564
  • FLJ43066
  • HMERF
  • LGMD2JFLJ26020
  • MPRM
  • Rhabdomyosarcoma antigen MU-RMS-40.14
  • titin
  • TMDFLJ26409

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Myosin Heavy Chain
Antibody (MF20) [Unco ...
MAB4470
Myosin Heavy Chain was detected in immersion fixed paraffin-embedded sections of human skeletal muscle using Mouse Anti-Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to sarcoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Myosin Heavy Chain was detected in perfusion fixed frozen sections of mouse skeletal muscle using Mouse Anti-Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to sarcoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Myosin Heavy Chain was detected in immersion fixed C2C12 mouse myoblast cell line using Mouse Anti-Human Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counter­stained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(6 Reviews)
(50 Publications)
Species: All-Multi
Applications: WB, IHC, ICC
Nebulin Antibody
NBP1-87752
Immunohistochemistry-Paraffin: Nebulin Antibody [NBP1-87752] - Staining of human tonsil shows no positivity in lymphoid cells as expected.
Immunohistochemistry-Paraffin: Nebulin Antibody [NBP1-87752] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: Nebulin Antibody [NBP1-87752] - Staining of human skeletal muscle shows high expression.
Species: Hu
Applications: IHC, IHC-P
Desmin Antibody
AF3844
Desmin was detected in immersion fixed frozen sections of mouse skeletal muscle using Human Desmin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3844) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to z-lines. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Desmin was detected in immersion fixed paraffin-embedded sections of human heart using 15 µg/mL Human Desmin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3844) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the sarcoplasm of cardiomyocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(13 Publications)
Species: Hu, Mu
Applications: IHC
Calpain 3 Antibody
NBP1-31756
Western Blot: Calpain 3 Antibody [NBP1-31756] - Sample (30 ug of whole cell lysate) A: Molt-4 10% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Calpain 3 Antibody [NBP1-31756] - Analysis of methanol-fixed HeLa, using antibody at 1:200 dilution.
Species: Hu
Applications: WB, ICC/IF
TCAP Antibody
NBP1-85544
Western Blot: TCAP Antibody [NBP1-85544] - Analysis in human skeletal muscle tissue.
Immunohistochemistry-Paraffin: TCAP Antibody [NBP1-85544] - Staining of human liver shows no positivity in hepatocytes as expected.
Western Blot: TCAP Antibody [NBP1-85544] - Analysis in control (vector only transfected HEK293T lysate) and TCAP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Species: Hu
Applications: WB, IHC, IHC-P
Fibronectin
Antibody
NBP1-91258
Western Blot: Fibronectin Antibody [NBP1-91258] - VSOP observed in perivascular-restricted spinal cord lesions with intact BBB. Immunostaining for laminin (brown) shows vascular endothelium and glia limitans of a perivascular lesion, along with infiltrating cells and VSOP (blue). Image collected and cropped by CiteAb from the following publication (http://asn.sagepub.com/lookup/doi/10.1042/AN20120081), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Fibronectin Antibody [NBP1-91258] - NIH-3T3 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-Fibronectin at 2 ug/mL overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at 1:500. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at 1:1000 and detected with an anti-mouse DyLight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Analysis in a 6 month old Alport mouse kidney. Image from a verified customer review.
(11 Reviews)
(30 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
OBSCN Antibody
NBP1-88818
Immunocytochemistry/Immunofluorescence: OBSCN Antibody [NBP1-88818] - Staining of human cell line A-431 shows localization to nuclear bodies, plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: OBSCN Antibody [NBP1-88818] - Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: OBSCN Antibody [NBP1-88818] - Staining of human liver shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining in human skeletal muscle and tonsil tissues. Corresponding DMD RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human heart muscle shows strong membranous positivity in myocytes.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human skeletal muscle shows strong membranous positivity in myocytes.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
ANKRD1 Antibody
NBP2-15397
Western Blot: ANKRD1 Antibody [NBP2-15397] - Sample (30 ug of whole cell lysate) A: A431 B: Jurkat 10% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: ANKRD1 Antibody [NBP2-15397] - Paraformaldehyde-fixed A431, using antibody at 1:200 dilution.
Western Blot: ANKRD1 Antibody [NBP2-15397] - Sample (50 ug of whole cell lysate) A: mouse heart 10% SDS PAGE; antibody diluted at 1:1000.
Species: Hu, Mu
Applications: WB, ICC/IF
Afamin Antibody
NBP2-15304
Western Blot: Afamin Antibody [NBP2-15304] - Sample (30 ug of whole cell lysate) A: 293T B: A431 C: HeLa D: HepG2 7. 5% SDS PAGE; antibody diluted at 1:5000.
Immunocytochemistry/Immunofluorescence: Afamin Antibody [NBP2-15304] - Analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: Afamin Antibody [NBP2-15304] - Paraffin-embedded human colon. AFM antibody diluted at 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
KCNT1
Overexpression Lysate
NBL1-12204
Western Blot: KCNT1 Overexpression Lysate (Adult Normal) [NBL1-12204] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for KCNT1.
Species: Hu
Vinculin Antibody
(hVIN-1)
NB600-1293
Immunocytochemistry/Immunofluorescence: Vinculin Antibody (hVIN-1) [NB600-1293] - Reduction of directionality and focal adhesion turnover by low eribulin concentrations. Immunofluorescence images of LM8 cells treated with 0 nM, 1 nM, or 10 nM eribulin and stained for vinculin (red) and nucleus (blue) (left). Dotted line shows the cell shape. Scale bar: 10 um. Quantitative analysis of the area of vinculin staining (right). Values are mean +/- SEM (>=30 cells per group). **P < 0.01. Image collected and cropped by CiteAb from the following publication (http://www.oncotarget.com/fulltext/26536) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Vinculin Antibody (hVIN-1) [NB600-1293] - MCF7 breast carcinoma cells expressing GFP fused CIN85 were labeled at a 1:400 dilution.
Immunocytochemistry/Immunofluorescence: Vinculin Antibody (hVIN-1) [NB600-1293] - Primary human osteoblast cells labeled (red), actin was stained with Phalloidin (green) and nuclei stained blue.
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr, Single-Cell Western
MHC Class I
Antibody (OX18)
NB120-6405
Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - PC12 cells were fixed for 10 minutes using 4% PFA and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-MHC Class I Antibody (OX18) at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: MHC Class I Antibody (OX18) [NB120-6405] - Analysis of FFPE rat brain cerebellum using MHC Class I (OK18) antibody at 1:200 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Endothelial staining was observed. Staining was performed by Histowiz.
Flow Cytometry: MHC Class I Antibody (OX18) [NB120-6405] - Analysis using the FITC conjugate of NB120-6405. Staining of rat spleen cells with mouse anti-rat RT1-A (OX18).
(32 Publications)
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
CSRP3 Antibody
NBP1-06983
Western Blot: CSRP3 Antibody [NBP1-06983] - (0.01ug/ml) staining of Human (A), Mouse (B) and Rat (C) Heart lysate (35ug protein in RIPA buffer). Detected by chemiluminescence.
Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP1-06983] - staining of paraffin embedded Human Heart. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP1-06983] - Staining of paraffin embedded Human Skeletal Muscle. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
Gelsolin/GSN
Antibody
NBP1-33177
Western Blot: Gelsolin/GSN Antibody [NBP1-33177] - Non-transfected (-) and transfected (+) HeLa whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with Gelsolin antibody [C2C3], C-term.
Immunocytochemistry/Immunofluorescence: Gelsolin/GSN Antibody [NBP1-33177] - Methanol-fixed HeLa, using Gelsolin antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled with Red at 1:2000.
Immunohistochemistry-Paraffin: Gelsolin/GSN Antibody [NBP1-33177] - H1299 xenograft, using Gelsolin antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Ryanodine Receptor
Antibody (34C)
NB300-543
Immunohistochemistry-Paraffin: Ryanodine Receptor Antibody (34C) [NB300-543] - Biopsies of deparaffinized Human skeletal muscle tissue.
(12 Publications)
Species: Hu, Mu, Rt, Am, Bv, Ca, Ma, Fi, Ma-Mn, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
Calpain 3 Antibody
NBP1-31756
Western Blot: Calpain 3 Antibody [NBP1-31756] - Sample (30 ug of whole cell lysate) A: Molt-4 10% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Calpain 3 Antibody [NBP1-31756] - Analysis of methanol-fixed HeLa, using antibody at 1:200 dilution.
Species: Hu
Applications: WB, ICC/IF
Ryanodine Receptor
2 Antibody
NBP2-76961
Immunocytochemistry/Immunofluorescence: Ryanodine Receptor 2 Antibody [NBP2-76961] - ICC staining RYR2 in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry: Ryanodine Receptor 2 Antibody [NBP2-76961] - Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue using anti-RYR2 antibody. Counter stained with hematoxylin.
Flow Cytometry: Ryanodine Receptor 2 Antibody [NBP2-76961] - Flow cytometric analysis of 293T cells with RYR2 antibody at 1/100 dilution (fuchsia) compared with an unlabelled control (cells without incubation with primary antibody; yellow). Alexa Fluor 488-conjugated goat anti-rabbit IgG was used as the secondary antibody.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Vimentin Antibody
NB300-223
Western Blot: Vimentin Antibody [NB300-223] - Analysis of tissue and cell lysates. Antibody at 1:5000 in red. [1] protein standard (red), [2] rat whole brain lysate, [3] HeLa, [4] SH-SY5Y, [5] HEK293, and [6] NIH-3T3 cell lysates. NB300-223 binds to the vimentin protein showing a single band at ~50 kDa. The blot was simultaneously probed with mouse mAb to MAP2C/D, dilution 1:5000 in green, revealing multiple bands around 280 kDa that correspond to full length MAP2A/2B isotypes, and ~70 kDa bands which are MAP2C/D isotypes. MAP2 isotypes are seen only in extracts containing neuronal lineage cells.
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Comparative analysis of epithelial and mesenchymal markers expressions. Fluorescence immunocytochemistry staining for E-cadherin (green), N-cadherin (red) and vimentin (cyan) was performed on esophageal cancer cells under static and microfluidic flow conditions at different time points. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep38221), licensed under a CC-BY licence.
Immunohistochemistry: Vimentin Antibody [NB300-223] - Increased numbers of differentiating NSPCs in SVZ of G93A-SOD1 brain. Confocal microscopy images of dorsal and ventral regions of SVZ in G93A-SOD1 and Wt-SOD1 brain at postnatal week 18, stained for nestin (green), GFAP (red), and vimentin (blue). Scale bar = 50 um. Image collected and cropped by CiteAb from the following publication (http://www.molecularbrain.com/content/8/1/5), licensed under a CC-BY licence.
(6 Reviews)
(44 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Titin Antibody
NBP1-88071
Titin Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Titin Antibody (NBP1-88071)(3)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 2 applications: ICC/IF, IHC.


Filter By Application
ICC/IF
(1)
IHC
(1)
All Applications
Filter By Species
Human
(1)
Rat
(1)
All Species

Reviews for Titin Antibody (NBP1-88071) (0)

There are no reviews for Titin Antibody (NBP1-88071). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Titin Antibody (NBP1-88071) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Titin Products

Array NBP1-88071

Bioinformatics Tool for Titin Antibody (NBP1-88071)

Discover related pathways, diseases and genes to Titin Antibody (NBP1-88071). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Titin Antibody (NBP1-88071)

Discover more about diseases related to Titin Antibody (NBP1-88071).
 

Pathways for Titin Antibody (NBP1-88071)

View related products by pathway.

PTMs for Titin Antibody (NBP1-88071)

Learn more about PTMs related to Titin Antibody (NBP1-88071).
 

Research Areas for Titin Antibody (NBP1-88071)

Find related products by research area.

Blogs on Titin

There are no specific blogs for Titin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Titin Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TTN