Titin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Titin Antibody [NBP1-88071] - SMYD2 Cys13 glutathionylation or oxidation reduces myofibril integrity. Monitoring the myofibril alignment in rat neonatal cardiomyocytes upon ...read more
Immunohistochemistry-Paraffin: Titin Antibody [NBP1-88071] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Titin Antibody [NBP1-88071] - Analysis in human skeletal muscle and liver tissues. Corresponding TTN RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Titin Antibody [NBP1-88071] - Staining of human fallopian tube shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Titin Antibody [NBP1-88071] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Titin Antibody [NBP1-88071] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Titin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYT
Specificity
Specificity of human Titin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
HIER pH6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID: 30337525).
Control Peptide
Titin Protein (NBP1-88071PEP)
Publications
Read Publications using
NBP1-88071 in the following applications:

Reactivity Notes

Rat reactivity reported in the scientific literature (PMID: 30337525).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Titin Antibody

  • cardiomyopathy, dilated 1G (autosomal dominant)
  • CMD1G
  • CMH9
  • CMPD4
  • connectin
  • DKFZp451N061
  • EC 2.7.11.1
  • EOMFC
  • FLJ32040
  • FLJ34413
  • FLJ39564
  • FLJ43066
  • HMERF
  • LGMD2JFLJ26020
  • MPRM
  • Rhabdomyosarcoma antigen MU-RMS-40.14
  • titin
  • TMDFLJ26409

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4470
Species: All-Multi
Applications: WB, IHC, ICC
NBP1-87752
Species: Hu
Applications: IHC, IHC-P
AF3844
Species: Hu, Mu
Applications: IHC
NBP1-31756
Species: Hu
Applications: WB, ICC/IF
NBP1-85544
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88818
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-15397
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12204
Species: Hu
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr, Single-Cell Western
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ma, Fi, Ma-Mn, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NBP1-31756
Species: Hu
Applications: WB, ICC/IF
NBP2-76961
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Titin Antibody (NBP1-88071)(3)

Reviews for Titin Antibody (NBP1-88071) (0)

There are no reviews for Titin Antibody (NBP1-88071). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Titin Antibody (NBP1-88071) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Titin Products

Array NBP1-88071

Bioinformatics Tool for Titin Antibody (NBP1-88071)

Discover related pathways, diseases and genes to Titin Antibody (NBP1-88071). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Titin Antibody (NBP1-88071)

Discover more about diseases related to Titin Antibody (NBP1-88071).
 

Pathways for Titin Antibody (NBP1-88071)

View related products by pathway.

PTMs for Titin Antibody (NBP1-88071)

Learn more about PTMs related to Titin Antibody (NBP1-88071).
 

Research Areas for Titin Antibody (NBP1-88071)

Find related products by research area.

Blogs on Titin

There are no specific blogs for Titin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Titin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TTN