tropomyosin-2 Antibody - Azide and BSA Free

Western Blot: tropomyosin-2 Antibody [NBP2-95197] - Analysis of extracts of various cell lines, using tropomyosin-2 at 1:400 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.

Immunohistochemistry-Paraffin: tropomyosin-2 Antibody [NBP2-95197] - Rat heart using TPM2 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: tropomyosin-2 Antibody [NBP2-95197] - Human stomach using TPM2 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: tropomyosin-2 Antibody [NBP2-95197] - Mouse heart using TPM2 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunoprecipitation: tropomyosin-2 Antibody [NBP2-95197] - Analysis of 300ug extracts of Mouse skeletal muscle cells using 3ug TPM2 antibody. Western blot was performed from the immunoprecipitate using TPM2 antibody at a dilition of 1:1000.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

tropomyosin-2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit tropomyosin-2 Antibody - Azide and BSA Free (NBP2-95197) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human tropomyosin-2 (NP_003280.2). MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVKEAQEKLEQAEKKATDAEADVASLNRRIQLVEEELD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TPM2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:100
  • Immunohistochemistry 1:50-1:100
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:500-1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for tropomyosin-2 Antibody - Azide and BSA Free

• distal, type 1
• tropomyosin 2 (beta)

Background

The tropomyosin-2 gene encodes beta-tropomyosin, a member of the actin filament binding protein family, and mainly expressed in slow, type 1 muscle fibers. Mutations in this gene can alter the expression of other sarcomeric tropomyosin proteins, and cause cap disease,

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: TPM2