| Reactivity | Hu, Mu, Rt, Fe, PmSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | IU5C1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 1.0 mg/ml |
| Immunogen | A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot# P33527] |
| Epitope | Residues 14-19 (PLWDWN) of the human protein. |
| Predicted Species | Rat (96%), Primate (96%), Feline (96%). Backed by our 100% Guarantee. |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ABCC1 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This MRP1 antibody is useful for Immunocytochemistry/Immunofluorescence and Western blot analysis on transfected lysate, where a band is seen at ~172 kDa. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Theoretical MW | 172 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS |
| Preservative | 0.1% Sodium Azide |
| Concentration | 1.0 mg/ml |
| Purity | Protein G purified |
| Publication using NB110-57131 | Applications | Species |
|---|---|---|
| Chen Q, Yang Y, Li L, Zhang JT. The amino terminus of the human multidrug resistance transporter ABCC1 has a U-shaped folding with a gating function. J Biol Chem;281(41):31152-63. 2006-10-13 [PMID: 16914551] (ICC/IF, Human) | ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for MRP1 Antibody (NB110-57131)Find related products by research area.
|
|
ABC Membrane transporters and the role of MRP1 in drug resistance ATP-binding cassette (ABC) transporters, alongside ion channels and aquaporins, are ubiquitous membrane-bound proteins that move substrates across extra and intra cellular membranes. Multidrug resistance-associated protein 1 (MRP1) is a member o... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.