MRP1 Antibody (IU5C1) [Alexa Fluor™ Plus 594] Summary
| Immunogen |
A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot# P33527] |
| Epitope |
Residues 14-19 (PLWDWN) of the human protein. |
| Predicted Species |
Rat (96%), Primate (96%), Feline (96%). Backed by our 100% Guarantee. |
| Isotype |
IgG1 |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
ABCC1 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Chicken (88%), Bovine (87%), Drosophila melanogaster (72%).
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Protein G purified |
Notes
This product is provided under an intellectual property license from Life Technologies Corporation. The transfer of this product is conditioned on the buyer using the purchased product solely in research conducted by the buyer, excluding contract research or any fee for service research, and the buyer must not (1) use this product or its components for (a) diagnostic, therapeutic or prophylactic purposes; (b) testing, analysis or screening services, or information in return for compensation on a per-test basis; or (c) manufacturing or quality assurance or quality control, and/or (2) sell or transfer this product or its components for resale, whether or not resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5781 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@thermofisher.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
Alternate Names for MRP1 Antibody (IU5C1) [Alexa Fluor™ Plus 594]
Background
Multidrug Resistance Protein 1 (MRP1) is an integral membrane glycophosphoprotein belonging to the same superfamily of ATP-binding cassette transmembrane transporter proteins as P-glycoprotein. MRP1 is overexpressed in many P-glycoprotein-negative, multidrug resistant cell lines and tumours. It is believed that the main function of MRP in drug resistance is that of a plasma membrane drug efflux pump.
Specifically, MRP1 mediates the export of organic anions and drugs from the cytoplasm. It is through this function, that MRP1 is able to confer resistance to anticancer drugs. MRP1 antibodies are therefore useful tools for cancer testing and research.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Publications for MRP1 Antibody (NB110-57131AFP594) (0)
There are no publications for MRP1 Antibody (NB110-57131AFP594).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MRP1 Antibody (NB110-57131AFP594) (0)
There are no reviews for MRP1 Antibody (NB110-57131AFP594).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MRP1 Antibody (NB110-57131AFP594) (0)