| Reactivity | Hu, Mu, Rt, Fe, PmSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | IU5C1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | DyLight 680 |
| Immunogen | A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot# P33527] |
| Epitope | Residues 14-19 (PLWDWN) of the human protein. |
| Predicted Species | Rat (96%), Primate (96%), Feline (96%). Backed by our 100% Guarantee. |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ABCC1 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Optimal dilution of this antibody should be experimentally determined. |
| Storage | Store at 4C in the dark. |
| Buffer | 50mM Sodium Borate |
| Preservative | 0.05% Sodium Azide |
| Purity | Protein G purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for MRP1 Antibody (NB110-57131FR)Find related products by research area.
|
|
ABC Membrane transporters and the role of MRP1 in drug resistance ATP-binding cassette (ABC) transporters, alongside ion channels and aquaporins, are ubiquitous membrane-bound proteins that move substrates across extra and intra cellular membranes. Multidrug resistance-associated protein 1 (MRP1) is a member o... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ABCC1 |