We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MRP1 Antibody (IU5C1) [Alexa Fluor® 350]

Images

 
There are currently no images for MRP1 Antibody (NB110-57131AF350).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity Hu, Mu, Rt, Fe, PmSpecies Glossary
Applications WB, ICC/IF, IHC
Clone
IU5C1
Clonality
Monoclonal
Host
Mouse
Conjugate
Alexa Fluor 350

Order Details

MRP1 Antibody (IU5C1) [Alexa Fluor® 350] Summary

Description
This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. All conjugates are generated using validated conjugation protocols and meet strict degree of labeling (F/P) specifications; additional information is available upon request. The antibody concentration is provided on the individual product label.

For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available.
Immunogen
A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot# P33527]
Epitope
Residues 14-19 (PLWDWN) of the human protein.
Predicted Species
Rat (96%), Primate (96%), Feline (96%). Backed by our 100% Guarantee.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
ABCC1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
Application Notes
Recommended applications are based on validated applications from the unconjugated base product NB110-57131. This conjugated antibody is not kept in inventory and is made to order using validated conjugation protocols.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Chicken (88%), Bovine (87%), Drosophila melanogaster (72%).

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein G purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for MRP1 Antibody (IU5C1) [Alexa Fluor® 350]

  • ABC29
  • ABCC
  • ABCC1
  • ATP-binding cassette sub-family C member 1
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 1
  • EC 3.6.3
  • EC 3.6.3.44
  • GS-X
  • Leukotriene C(4) transporter
  • LTC4 transporter
  • MRP1
  • MRP1DKFZp781G125
  • MRPDKFZp686N04233
  • multidrug resistance associated protein 1
  • multidrug resistance protein
  • multidrug resistance-associated protein 1
  • multiple drug resistance protein 1
  • multiple drug resistance-associated protein

Background

Multidrug Resistance Protein 1 (MRP1) is an integral membrane glycophosphoprotein belonging to the same superfamily of ATP-binding cassette transmembrane transporter proteins as P-glycoprotein. MRP1 is overexpressed in many P-glycoprotein-negative, multidrug resistant cell lines and tumours. It is believed that the main function of MRP in drug resistance is that of a plasma membrane drug efflux pump.

Specifically, MRP1 mediates the export of organic anions and drugs from the cytoplasm. It is through this function, that MRP1 is able to confer resistance to anticancer drugs. MRP1 antibodies are therefore useful tools for cancer testing and research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-42349
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-76670
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-82820
Species: Hu
Applications: ICC/IF,  IHC-P, Simple Western, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-1471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, PEP-ELISA, WB
AF6278
Species: Hu, Mu
Applications: WB
NBP2-46467
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-64808
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
NBP3-14454
Species: Hu
Applications: IHC,  IHC-P
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP3-24587
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-42342
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB

Publications for MRP1 Antibody (NB110-57131AF350) (0)

There are no publications for MRP1 Antibody (NB110-57131AF350).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRP1 Antibody (NB110-57131AF350) (0)

There are no reviews for MRP1 Antibody (NB110-57131AF350). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MRP1 Antibody (NB110-57131AF350) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRP1 Products

Research Areas for MRP1 Antibody (NB110-57131AF350)

Find related products by research area.

Blogs on MRP1.

ABC Membrane transporters and the role of MRP1 in drug resistance
ATP-binding cassette (ABC) transporters, alongside ion channels and aquaporins, are ubiquitous membrane-bound proteins that move substrates across extra and intra cellular membranes.  Multidrug resistance-associated protein 1 (MRP1) is a member o...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRP1 Antibody (IU5C1) [Alexa Fluor® 350] and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCC1