| Reactivity | Hu, Mu, Rt, Fe, PmSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | IU5C1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | mFluor Violet 500 SE |
| Description | This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. All conjugates are generated using validated conjugation protocols and meet strict degree of labeling (F/P) specifications; additional information is available upon request. The antibody concentration is provided on the individual product label. For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available. |
| Immunogen | A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot# P33527] |
| Epitope | Residues 14-19 (PLWDWN) of the human protein. |
| Predicted Species | Rat (96%), Primate (96%), Feline (96%). Backed by our 100% Guarantee. |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ABCC1 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Recommended applications are based on validated applications from the unconjugated base product NB110-57131. This conjugated antibody is not kept in inventory and is made to order using validated conjugation protocols. |
| Storage | Store at 4C in the dark. |
| Buffer | 50mM Sodium Borate |
| Preservative | 0.05% Sodium Azide |
| Purity | Protein G purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for MRP1 Antibody (NB110-57131MFV500)Find related products by research area.
|
|
ABC Membrane transporters and the role of MRP1 in drug resistance ATP-binding cassette (ABC) transporters, alongside ion channels and aquaporins, are ubiquitous membrane-bound proteins that move substrates across extra and intra cellular membranes. Multidrug resistance-associated protein 1 (MRP1) is a member o... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ABCC1 |