MRAP Antibody


Immunohistochemistry: MRAP Antibody [NBP1-88941] - Staining of human rectum shows strong positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

MRAP Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHS
Specificity of human MRAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MRAP Protein (NBP1-88941PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MRAP Antibody

  • B27GCCD2
  • C21orf61chromosome 21 open reading frame 61
  • Fat cell-specific low molecular weight protein
  • Fat tissue-specific low MW protein
  • melanocortin 2 receptor accessory protein
  • melanocortin-2 receptor accessory protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt, Po, Bv, Eq, Gt, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, Neut
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P

Publications for MRAP Antibody (NBP1-88941) (0)

There are no publications for MRAP Antibody (NBP1-88941).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRAP Antibody (NBP1-88941) (0)

There are no reviews for MRAP Antibody (NBP1-88941). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MRAP Antibody (NBP1-88941) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MRAP Products

Bioinformatics Tool for MRAP Antibody (NBP1-88941)

Discover related pathways, diseases and genes to MRAP Antibody (NBP1-88941). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRAP Antibody (NBP1-88941)

Discover more about diseases related to MRAP Antibody (NBP1-88941).

Pathways for MRAP Antibody (NBP1-88941)

View related products by pathway.

PTMs for MRAP Antibody (NBP1-88941)

Learn more about PTMs related to MRAP Antibody (NBP1-88941).

Blogs on MRAP

There are no specific blogs for MRAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MRAP Antibody and receive a gift card or discount.


Gene Symbol MRAP