MRAP Antibody - BSA Free

Immunohistochemistry-Paraffin-MRAP Antibody-NBP1-88941-Staining of human adrenal gland shows moderate granular cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRAP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MRAP Antibody - BSA Free (NBP1-88941) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRAP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MRAP Protein (NBP1-88941PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MRAP Antibody - BSA Free

• B27GCCD2
• C21orf61chromosome 21 open reading frame 61
• FALPFGD2
• Fat cell-specific low molecular weight protein
• Fat tissue-specific low MW protein
• melanocortin 2 receptor accessory protein
• melanocortin-2 receptor accessory protein

Background

The MRAP gene encodes a melanocortin receptor-interacting protein. The encoded protein regulates trafficking and function of the melanocortin 2 receptor in the adrenal gland. The encoded protein can also modulate signaling of other melanocortin receptors. Mut

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRAP