ATP6V0A2 Antibody


Western Blot: ATP6V0A2 Antibody [NBP1-59069] - HeLa cells, concentration 3.3 ug/ml.
Immunohistochemistry: ATP6V0A2 Antibody [NBP1-59069] - Human kidney lysate tissue at an antibody concentration of 5.0 ug/ml using anti-ATP6V0A2 antibody
Western Blot: ATP6V0A2 Antibody [NBP1-59069] - Hela tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry-Paraffin: ATP6V0A2 Antibody [NBP1-59069] - overexpressed mouse sequences tissue
Immunohistochemistry: ATP6V0A2 Antibody [NBP1-59069] - Application: IHC/Immunofluorescence Species+tissue/cell type:A. untransfected HeLa cellsB. transfected HeLa cellsC. mATP6V0A2 (partial) transfected HeLa cells more

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

ATP6V0A2 Antibody Summary

Synthetic peptides corresponding to ATP6V0A2(ATPase, H+ transporting, lysosomal V0 subunit a2) The peptide sequence was selected from the N terminal of ATP6V0A2. Peptide sequence INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN. The peptide sequence for this immunogen was taken from within the described region.
This product is specific to Subunit or Isoform: a isoform 2.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ATP6V0A2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ATP6V0A2 Antibody

  • A2
  • ARCL
  • ATP6A2
  • ATP6N1D
  • ATP6V0
  • ATPase, H+ transporting, lysosomal V0 subunit a isoform 2
  • ATPase, H+ transporting, lysosomal V0 subunit a2
  • infantile malignant osteopetrosis
  • J6B7
  • Lysosomal H(+)-transporting ATPase V0 subunit a2
  • regeneration and tolerance factor
  • RTF
  • STV1
  • TJ6A2V-ATPase
  • TJ6M
  • TJ6S
  • Vacuolar proton translocating ATPase 116 kDa subunit a isoform 2
  • vacuolar proton translocating ATPase 116 kDa subunit a
  • V-ATPase 116 kDa isoform a2
  • v-ATPase 116 kDa
  • Vph1
  • V-type proton ATPase 116 kDa subunit a isoform 2
  • v-type proton ATPase 116 kDa subunit a
  • WSS


The multisubunit vacuolar-type proton pump (H(+)-ATPase or V-ATPase) is essential for acidification of diverse cellular components, including endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin granules, and it is found at high density in the plasma membrane of certain specialized cells. H(+)-ATPases are comprised of a peripheral V(1) domain and an integral membrane V(0) domain; ATP6V0A2 is a component of the V(0) domain.The multisubunit vacuolar-type proton pump (H(+)-ATPase or V-ATPase) is essential for acidification of diverse cellular components, including endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin granules, and it is found at high density in the plasma membrane of certain specialized cells. H(+)-ATPases are comprised of a peripheral V(1) domain and an integral membrane V(0) domain; ATP6V0A2 is a component of the V(0) domain (Smith et al., 2003 [PubMed 14580332]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-Fr, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for ATP6V0A2 Antibody (NBP1-59069) (0)

There are no publications for ATP6V0A2 Antibody (NBP1-59069).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V0A2 Antibody (NBP1-59069) (0)

There are no reviews for ATP6V0A2 Antibody (NBP1-59069). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATP6V0A2 Antibody (NBP1-59069) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ATP6V0A2 Products

Bioinformatics Tool for ATP6V0A2 Antibody (NBP1-59069)

Discover related pathways, diseases and genes to ATP6V0A2 Antibody (NBP1-59069). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V0A2 Antibody (NBP1-59069)

Discover more about diseases related to ATP6V0A2 Antibody (NBP1-59069).

Pathways for ATP6V0A2 Antibody (NBP1-59069)

View related products by pathway.

PTMs for ATP6V0A2 Antibody (NBP1-59069)

Learn more about PTMs related to ATP6V0A2 Antibody (NBP1-59069).

Blogs on ATP6V0A2

There are no specific blogs for ATP6V0A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ATP6V0A2 Antibody and receive a gift card or discount.


Gene Symbol ATP6V0A2