Recombinant Human HLA DRB4 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human HLA DRB4 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-237 of Human HLA-DRB4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GDTQPRFLEQAKCECRFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
HLA-DRB4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
51.81 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HLA DRB4 GST (N-Term) Protein

  • class II histocompatibility antigen HLA DR alpha, beta1-0307
  • DR12
  • DR-12
  • DR13
  • DR-13
  • DR14
  • DR-14
  • DR4
  • DR-4
  • DRB1 transplantation antigen
  • DRB4
  • HLA class II histocompatibility antigen, DR beta 4 chain
  • HLA class II histocompatibility antigen, DRB1-12 beta chain
  • HLA class II histocompatibility antigen, DRB1-4 beta chain
  • HLA-DR4B
  • human leucocyte antigen DRB4
  • leucocyte antigen DRB1
  • leukocyte antigen
  • major histocompatibility complex, class II, DR beta 1
  • major histocompatibility complex, class II, DR beta 4
  • MHC class I antigen DRB1*12
  • MHC class I antigen DRB1*4
  • MHC class II antigen DRB1*12
  • MHC class II antigen DRB1*13
  • MHC class II antigen DRB1*14
  • MHC class II antigen DRB1*4
  • MHC class II antigen DRB4
  • MHC class II antigen HLA-DRB1
  • MHC class II antigen HLA-DR-beta
  • MHC class II HLA-DR-beta-7
  • MHC class2 antigen
  • MHC HLA DR-beta chain

Background

HLA-DRB4( AAH05312, 30 a.a. - 267 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-64775
Species: Pm, Bv, Hu, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), IP
210-TA
Species: Hu
Applications: BA
NB100-56618
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
375-TL
Species: Hu
Applications: BA
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-50419
Species: Hu
Applications: CyTOF-ready, Flow, IP
NBP1-43123
Species: Hu
Applications: B/N, CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, Simple Western
NBP1-89688
Species: Hu
Applications: IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
AF347
Species: Hu
Applications: IHC, Neut, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP3-16006
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-47480
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
MAB943
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-14984
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
H00003126-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for HLA DRB4 Recombinant Protein (H00003126-P01) (0)

There are no publications for HLA DRB4 Recombinant Protein (H00003126-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DRB4 Recombinant Protein (H00003126-P01) (0)

There are no reviews for HLA DRB4 Recombinant Protein (H00003126-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLA DRB4 Recombinant Protein (H00003126-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HLA DRB4 Products

Bioinformatics Tool for HLA DRB4 Recombinant Protein (H00003126-P01)

Discover related pathways, diseases and genes to HLA DRB4 Recombinant Protein (H00003126-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLA DRB4 Recombinant Protein (H00003126-P01)

Discover more about diseases related to HLA DRB4 Recombinant Protein (H00003126-P01).
 

Pathways for HLA DRB4 Recombinant Protein (H00003126-P01)

View related products by pathway.

PTMs for HLA DRB4 Recombinant Protein (H00003126-P01)

Learn more about PTMs related to HLA DRB4 Recombinant Protein (H00003126-P01).
 

Research Areas for HLA DRB4 Recombinant Protein (H00003126-P01)

Find related products by research area.

Blogs on HLA DRB4

There are no specific blogs for HLA DRB4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HLA DRB4 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DRB4