ATP6V0A1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ATP6V0A1 Antibody [NBP1-89342] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human pancreas shows strong cytoplasmic positivity in islet cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP6V0A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP6V0A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATP6V0A1 Protein (NBP1-89342PEP)
Publications
Read Publication using
NBP1-89342 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28266544).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP6V0A1 Antibody

  • a1
  • ATP6N1
  • ATP6N1AATPase, H+ transporting, lysosomal non-catalytic accessory protein 1(110/116kD)
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalyticaccessory protein 1A (110/116kD)
  • ATPase, H+ transporting, lysosomal V0 subunit a isoform 1
  • ATPase, H+ transporting, lysosomal V0 subunit a1
  • Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit
  • DKFZp781J1951
  • Stv1
  • Vacuolar adenosine triphosphatase subunit Ac116
  • Vacuolar proton pump subunit 1
  • vacuolar proton pump, subunit 1
  • Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1
  • vacuolar proton translocating ATPase 116 kDa subunit A
  • vacuolar-type H(+)-ATPase 115 kDa subunit
  • V-ATPase 116 kDa isoform a1
  • V-ATPase 116 kDa
  • Vph1
  • VPP1H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1
  • V-type proton ATPase 116 kDa subunit a isoform 1
  • V-type proton ATPase 116 kDa subunit a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-62539
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF1936
Species: Hu
Applications: WB, IP
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for ATP6V0A1 Antibody (NBP1-89342)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: ICC/IF, IP.


Filter By Application
ICC/IF
(1)
IP
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for ATP6V0A1 Antibody (NBP1-89342) (0)

There are no reviews for ATP6V0A1 Antibody (NBP1-89342). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ATP6V0A1 Antibody (NBP1-89342) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP6V0A1 Products

Bioinformatics Tool for ATP6V0A1 Antibody (NBP1-89342)

Discover related pathways, diseases and genes to ATP6V0A1 Antibody (NBP1-89342). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V0A1 Antibody (NBP1-89342)

Discover more about diseases related to ATP6V0A1 Antibody (NBP1-89342).
 

Pathways for ATP6V0A1 Antibody (NBP1-89342)

View related products by pathway.

Blogs on ATP6V0A1

There are no specific blogs for ATP6V0A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP6V0A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V0A1