ATP6V0A1 Antibody

Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Analysis in human cerebral cortex and tonsil tissues. Corresponding ATP6V0A1 RNA-seq data are presented for the same tissues.

Western Blot: ATP6V0A1 Antibody [NBP1-89342] - In Cln1-/- mice V0a1 is misrouted to plasma membrane preventing its interaction with AP-3. Pull-down assay with AP-3 antibody using total lysates from untreated (lane 1) and bromopalmitate-treated (lane 2) WT brain slices to detect V0a1 and its densitometric quantitation (n=4, *P<0.05). HEK-293 cells were transfected with WT GFP-V0a1 and GFP-V0a1-Cys25Ser mutant construct, and pull-down experiments were conducted with AP-3 antibody to detect GFP-V0a1,*P<0.05(n=4). Image collected and cropped by CiteAb from the following publication (//www.nature.com/doifinder/10.1038/ncomms14612), licensed under a CC-BY licence.

Western Blot: ATP6V0A1 Antibody [NBP1-89342] - In Cln1-/- mice V0a1 is misrouted to plasma membrane preventing its interaction with AP-3. Western blot analysis and densitometric quantitation of V0a1 in isolated plasma membrane fraction from WT and Cln1-/- mouse brain (n=4, *P<0.05). Image collected and cropped by CiteAb from the following publication (//www.nature.com/doifinder/10.1038/ncomms14612), licensed under a CC-BY licence.

Immunocytochemistry/Immunofluorescence: ATP6V0A1 Antibody [NBP1-89342] - Staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.

Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human tonsil shows low expression as expected.

Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human kidney shows strong cytoplasmic postivity in cells in tubules.

Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human cerebellum shows strong cytoplasmic postivity in cells in granular layer.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ATP6V0A1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELK
• Specificity: Specificity of human ATP6V0A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Predicted Species: Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP6V0A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04 - 0.4 ug/mL
  • Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Immunoprecipitation
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Immunoprecipitation reported in scientific literature (PMID: 28266544). Use in WB reported in reported in scientific literature (PMID: 30804504).
• Control Peptide:

  ATP6V0A1 Recombinant Protein Antigen (NBP1-89342PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28266544).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2), 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ATP6V0A1 Antibody

• a1
• ATP6N1
• ATP6N1AATPase, H+ transporting, lysosomal non-catalytic accessory protein 1(110/116kD)
• ATP6V0
• ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalyticaccessory protein 1A (110/116kD)
• ATPase, H+ transporting, lysosomal V0 subunit a isoform 1
• ATPase, H+ transporting, lysosomal V0 subunit a1
• Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit
• DKFZp781J1951
• Stv1
• Vacuolar adenosine triphosphatase subunit Ac116
• Vacuolar proton pump subunit 1
• vacuolar proton pump, subunit 1
• Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1
• vacuolar proton translocating ATPase 116 kDa subunit A
• vacuolar-type H(+)-ATPase 115 kDa subunit
• V-ATPase 116 kDa isoform a1
• V-ATPase 116 kDa
• Vph1
• VPP1H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1
• V-type proton ATPase 116 kDa subunit a isoform 1
• V-type proton ATPase 116 kDa subunit a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP6V0A1 Antibody (NBP1-89342)(3)

Publications using NBP1-89342

• McGuire CM, Collins MP, Sun-Wada G et al. Isoform-specific gene disruptions reveal a role for the V-ATPase subunit a4 isoform in the invasiveness of 4T1-12B breast cancer cells J. Biol. Chem. Jun 5 2019 [PMID: 31167791] (WB, Mouse)
• Senturk M, Lin G, Zuo Z et al. Ubiquilins regulate autophagic flux through mTOR signalling and lysosomal acidification Nat. Cell Biol. Mar 1 2019 [PMID: 30804504] (WB, Human)
• Bagh MB, Peng S, Chandra G et al. Misrouting of v-ATPase subunit V0a1 dysregulates lysosomal acidification in a neurodegenerative lysosomal storage disease model. Nat Commun. Mar 7 2017 [PMID: 28266544] (ICC/IF, IP, Mouse)

Review for ATP6V0A1 Antibody (NBP1-89342) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Anonymous ICC Mouse 10/13/2020

Summary

• Application: Immunocytochemistry
• Sample Tested: Mouse embryonic fibroblasts
• Species: Mouse
• Lot: B96917

Bioinformatics

• Gene Symbol: ATP6V0A1