ATP6V0A1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Analysis in human cerebral cortex and tonsil tissues. Corresponding ATP6V0A1 RNA-seq data are presented for the same tissues.
Western Blot: ATP6V0A1 Antibody [NBP1-89342] - In Cln1-/- mice V0a1 is misrouted to plasma membrane preventing its interaction with AP-3. Pull-down assay with AP-3 antibody using total lysates from untreated (lane 1) ...read more
Western Blot: ATP6V0A1 Antibody [NBP1-89342] - In Cln1-/- mice V0a1 is misrouted to plasma membrane preventing its interaction with AP-3. Western blot analysis and densitometric quantitation of V0a1 in isolated plasma ...read more
Immunocytochemistry/ Immunofluorescence: ATP6V0A1 Antibody [NBP1-89342] - Staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human kidney shows strong cytoplasmic postivity in cells in tubules.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human cerebellum shows strong cytoplasmic postivity in cells in granular layer.
NDRG2 is correlated with increased survival and negatively correlated with GLUT1 in breast carcinoma. Kaplan–Meier analysis was carried out according to N-myc downstream-regulated gene 2 (NDRG2) expression levels of ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ATP6V0A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELK
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP6V0A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Immunoprecipitation -Reported in scientific literature (PMID: 28266544)
  • Western Blot Image collected and cropped by CiteAb from the following publication (http://www.nature.com/doifinder/10.1038/ncomms14612), licensed under a CC-BY license.
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATP6V0A1 Recombinant Protein Antigen (NBP1-89342PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-89342 in the following applications:

Publications
Read Publications using
NBP1-89342 in the following applications:

  • 2 publications
  • IHC
    1 publication
  • 1 publication
  • IP
    1 publication
  • WB
    6 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28266544).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP6V0A1 Antibody

  • a1
  • ATP6N1
  • ATP6N1AATPase, H+ transporting, lysosomal non-catalytic accessory protein 1(110/116kD)
  • ATP6V0
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalyticaccessory protein 1A (110/116kD)
  • ATPase, H+ transporting, lysosomal V0 subunit a isoform 1
  • ATPase, H+ transporting, lysosomal V0 subunit a1
  • Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit
  • DKFZp781J1951
  • Stv1
  • Vacuolar adenosine triphosphatase subunit Ac116
  • Vacuolar proton pump subunit 1
  • vacuolar proton pump, subunit 1
  • Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1
  • vacuolar proton translocating ATPase 116 kDa subunit A
  • vacuolar-type H(+)-ATPase 115 kDa subunit
  • V-ATPase 116 kDa isoform a1
  • V-ATPase 116 kDa
  • Vph1
  • VPP1H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1
  • V-type proton ATPase 116 kDa subunit a isoform 1
  • V-type proton ATPase 116 kDa subunit a

Background

ATP6V0A1 encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three A subunit proteins and the encoded protein is associated with clathrin-coated vesicles. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP6V0A1 Antibody (NBP1-89342)(12)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 5 applications: ICC/IF, IHC, IHC-P, IP, WB.


Filter By Application
ICC/IF
(2)
IHC
(1)
IHC-P
(1)
IP
(1)
WB
(6)
All Applications
Filter By Species
Human
(3)
Mouse
(3)
All Species
Showing Publications 1 - 10 of 12. Show All 12 Publications.
Publications using NBP1-89342 Applications Species
Schrag M, Solopova E, Romero-Fernandez W et al. Fatal Iatrogenic Cerebral Amyloid-Related Encephalitis in a patient treated with lecanemab for Alzheimer’s disease: neuroimaging and neuropathology. Research Square 2023-05-10 (IHC) IHC
Burrinha T, Cunha C, Hall MJ et al. Deacidification of endolysosomes by neuronal aging drives synapse loss Traffic (Copenhagen, Denmark) 2023-05-23 [PMID: 37218497]
Hoch L, Bourg N, Degrugillier F et al. Dual Blockade of Misfolded Alpha-Sarcoglycan Degradation by Bortezomib and Givinostat Combination Frontiers in Pharmacology 2022-04-27 [PMID: 35571097] (WB) WB
Yamazaki Y, Eura Y, Kokame K. V-ATPase V0a1 promotes Weibel-Palade body biogenesis through the regulation of membrane fission eLife 2021-12-14 [PMID: 34904569]
Ye C, Zeng P, Liu Y et al. Tau overload associated insufficient lysosomal hydrolysis activity through deacidification of lysosomes Research Square 2023-08-31 (WB, Mouse) WB Mouse
Solopova E, Romero-Fernandez W, Harmsen H et al. Fatal Iatrogenic Cerebral Amyloid-Related Encephalitis in a patient treated with lecanemab for Alzheimer’s disease: neuroimaging and neuropathology medRxiv 2023-04-29 (IHC-P, Human) IHC-P Human
Mori H, Peterson SK, Simmermon R et al. SCD1 and monounsaturated lipids are required for autophagy and survival of adipocytes bioRxiv : the preprint server for biology 2023-10-27 [PMID: 37961537] (WB) WB
McGuire CM, Collins MP, Sun-Wada G et al. Isoform-specific gene disruptions reveal a role for the V-ATPase subunit a4 isoform in the invasiveness of 4T1-12B breast cancer cells J. Biol. Chem. 2019-06-05 [PMID: 31167791] (WB, Mouse) WB Mouse
Senturk M, Lin G, et al. Ubiquilins regulate autophagic flux through mTOR signalling and lysosomal acidification. Nat Cell Biol 2019-03-01 [PMID: 30804504] (WB, Human) WB Human
Bagh MB, Peng S, Chandra G et al. Misrouting of v-ATPase subunit V0a1 dysregulates lysosomal acidification in a neurodegenerative lysosomal storage disease model. Nat Commun. 2017-03-07 [PMID: 28266544] (ICC/IF, IP, Mouse) ICC/IF, IP Mouse
Show All 12 Publications.

Review for ATP6V0A1 Antibody (NBP1-89342) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-89342:
Filter by Applications
ICC
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry ATP6V0A1 NBP1-89342
Enlarge
4
reviewed by:
Verified Customer
ICC Mouse 10/13/2020
View

Summary

ApplicationImmunocytochemistry
Sample TestedMouse embryonic fibroblasts
SpeciesMouse
LotB96917

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATP6V0A1 Antibody (NBP1-89342) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Verified Customer
10/13/2020
Application: ICC
Species: Mouse

Bioinformatics

Gene Symbol ATP6V0A1