MOBP Antibody

Images

 
Western Blot: MOBP Antibody [NBP1-89430] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: MOBP Antibody [NBP1-89430] - Staining of human cell line A-431 shows positivity in nucleus and vesicles.
Immunohistochemistry-Paraffin: MOBP Antibody [NBP1-89430] - Staining of human lateral ventricle shows strong dot-like positivity.
Immunohistochemistry-Paraffin: MOBP Antibody [NBP1-89430] - Staining of human placenta shows strong membranous and cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MOBP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MOBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
MOBP Protein (NBP1-89430PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MOBP Antibody

  • MGC87379
  • myelin-associated oligodendrocyte basic protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004340-B01P
Species: Hu, Rt
Applications: WB
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF163
Species: Hu, Mu, Rt
Applications: WB, IHC
AF2418
Species: Hu
Applications: WB, IHC, ChIP, ICC
AF1674
Species: Mu
Applications: WB
MAB4280
Species: Hu
Applications: Flow, CyTOF-ready
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
AF1440
Species: Mu
Applications: WB
NBP1-89430
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MOBP Antibody (NBP1-89430) (0)

There are no publications for MOBP Antibody (NBP1-89430).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOBP Antibody (NBP1-89430) (0)

There are no reviews for MOBP Antibody (NBP1-89430). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MOBP Antibody (NBP1-89430) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MOBP Products

Bioinformatics Tool for MOBP Antibody (NBP1-89430)

Discover related pathways, diseases and genes to MOBP Antibody (NBP1-89430). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOBP Antibody (NBP1-89430)

Discover more about diseases related to MOBP Antibody (NBP1-89430).
 

Pathways for MOBP Antibody (NBP1-89430)

View related products by pathway.

PTMs for MOBP Antibody (NBP1-89430)

Learn more about PTMs related to MOBP Antibody (NBP1-89430).
 

Research Areas for MOBP Antibody (NBP1-89430)

Find related products by research area.

Blogs on MOBP

There are no specific blogs for MOBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MOBP
Entrez
Uniprot