![Immunohistochemistry-Paraffin: MOBP Antibody [NBP1-89430] - Staining of human caudate shows strong dot-like positivity.](http://images.novusbio.com/fullsize2/MOBP-Antibody-Immunohistochemistry-Paraffin-NBP1-89430-img0011.jpg "Immunohistochemistry-Paraffin: MOBP Antibody [NBP1-89430] - Staining of human caudate shows strong dot-like positivity.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTR |
| Predicted Species | Mouse (96%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MOBP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Theoretical MW | 21 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Immunohistochemistry-Frozen-NB600-717-img0003.jpg)
-Immunohistochemistry-Frozen-NB600-717-img0004.jpg)
-Immunocytochemistry-Immunofluorescence-NB600-717-img0005.jpg)
![Western Blot Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Western_Blot_5819.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19720.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19954.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for MOBP Antibody (NBP1-89430)Discover more about diseases related to MOBP Antibody (NBP1-89430).
| Pathways for MOBP Antibody (NBP1-89430)View related products by pathway.
|
PTMs for MOBP Antibody (NBP1-89430)Learn more about PTMs related to MOBP Antibody (NBP1-89430).
| Research Areas for MOBP Antibody (NBP1-89430)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: MOBP Antibody [NBP1-89430] - Staining of human cerebral cortex shows moderate dot-like positivity.](http://images.novusbio.com/fullsize2/MOBP-Antibody-Immunohistochemistry-Paraffin-NBP1-89430-img0008.jpg "Immunohistochemistry-Paraffin: MOBP Antibody [NBP1-89430] - Staining of human cerebral cortex shows moderate dot-like positivity.")
![Immunohistochemistry-Paraffin: MOBP Antibody [NBP1-89430] - Staining of human duodenum shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize2/MOBP-Antibody-Immunohistochemistry-Paraffin-NBP1-89430-img0009.jpg "Immunohistochemistry-Paraffin: MOBP Antibody [NBP1-89430] - Staining of human duodenum shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: MOBP Antibody [NBP1-89430] - Staining of human kidney shows no positivity as expected.](http://images.novusbio.com/fullsize2/MOBP-Antibody-Immunohistochemistry-Paraffin-NBP1-89430-img0010.jpg "Immunohistochemistry-Paraffin: MOBP Antibody [NBP1-89430] - Staining of human kidney shows no positivity as expected.")
-Immunohistochemistry-NBP2-46617-img0001.jpg)
-Immunohistochemistry-NBP2-46617-img0002.jpg)
-Immunohistochemistry-NBP2-46617-img0003.jpg)
![Chromatin Immunoprecipitation (ChIP) Olig2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Olig2_AF2418_Chromatin_Immunoprecipitation_11228.jpg)
![Immunocytochemistry Olig2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Olig2_AF2418_Immunocytochemistry_6637.jpg)
![Immunohistochemistry Olig2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Olig2_AF2418_Immunohistochemistry_17205.jpg)
-Western-Blot-H00001958-M03-img0012.jpg)
-Western-Blot-H00001958-M03-img0014.jpg)
-Western-Blot-H00001958-M03-img0013.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")