OMgp Antibody

Images

 
Western Blot: OMgp Antibody [NBP1-82483] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82483] - Staining in human cerebral cortex and pancreas tissues using anti-OMG antibody. Corresponding OMG RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82483] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82483] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OMgp Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LPSGLQENIIHLNLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNK
Specificity
Specificity of human OMgp antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OMG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
OMgp Protein (NBP1-82483PEP)
Publications
Read Publication using NBP1-82483.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OMgp Antibody

  • oligodendrocyte myelin glycoprotein
  • OMG
  • OMgp
  • OMGPoligodendrocyte-myelin glycoprotein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004340-B01P
Species: Hu, Rt
Applications: WB
AF1440
Species: Mu
Applications: WB
NB100-56681
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
248-BD
Species: Hu, Mu, Rt, Ca, Eq
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NB110-40561
Species: Hu
Applications: WB, IP
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5789
Species: Hu, Mu, Rt
Applications: WB
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF3086
Species: Hu
Applications: WB, IHC
NB120-12126
Species: Hu, Mu
Applications: WB
AF3086
Species: Hu
Applications: WB, IHC

Publications for OMgp Antibody (NBP1-82483)(1)

Reviews for OMgp Antibody (NBP1-82483) (0)

There are no reviews for OMgp Antibody (NBP1-82483). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OMgp Antibody (NBP1-82483) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for OMgp Antibody (NBP1-82483)

Discover related pathways, diseases and genes to OMgp Antibody (NBP1-82483). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OMgp Antibody (NBP1-82483)

Discover more about diseases related to OMgp Antibody (NBP1-82483).
 

Pathways for OMgp Antibody (NBP1-82483)

View related products by pathway.

PTMs for OMgp Antibody (NBP1-82483)

Learn more about PTMs related to OMgp Antibody (NBP1-82483).

Blogs on OMgp

There are no specific blogs for OMgp, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OMgp Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OMG
Entrez