MIS/AMH Antibody

Images

 
Western Blot: MIS/AMH Antibody [NBP1-70639] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: MIS/AMH Antibody [NBP1-70639] - Human Prostate lysate tissue at an antibody concentration of 5.0 ug/ml using anti-AMH antibody
Western Blot: MIS/AMH Antibody [NBP1-70639] - Titration: 1 ug/ml Positive Control: Human Fetal Small Intestine cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MIS/AMH Antibody Summary

Immunogen
Synthetic peptides corresponding to AMH(anti-Mullerian hormone) The peptide sequence was selected from the middle region of AMH. Peptide sequence SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AMH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against AMH and was validated on Western blot.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MIS/AMH Antibody

  • AMH
  • MIF
  • MIS
  • Muellerian hormone
  • muellerian-inhibiting factor
  • muellerian-inhibiting substance
  • Mullerian hormone
  • Mullerian inhibiting factor
  • Mullerian inhibiting substance

Background

Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome.Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NB100-1985
Species: Hu, Mu(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
PP-H7431-00
Species: Hu
Applications: WB
NBP1-70639
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MIS/AMH Antibody (NBP1-70639) (0)

There are no publications for MIS/AMH Antibody (NBP1-70639).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MIS/AMH Antibody (NBP1-70639) (0)

There are no reviews for MIS/AMH Antibody (NBP1-70639). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MIS/AMH Antibody (NBP1-70639). (Showing 1 - 1 of 1 FAQ).

  1. We are working on a Sandwich ELISA platform for AMH assay. We have the following queries regarding the AMH antibodies: 1. Do you recommend any pairs of the antibodies for Sandwich Elisa platform for Human AMH protein detection? 2. Were the antibodies raised against recombinant protein or synthetic peptide or Native AMH protein? 3. What was the molecular weight of the AMH protein (140KDa or 22KDa) used to check the specificity of the antibodies?
    • In regards to your sandwich ELISA inquiry, I was able to find a potential pair of antibodies that may work for your experiment (catalog numbers NBP1-70639 and NBP2-11800). Neither of these antibodies has been tested in ELISA or as a pair, so we cannot guarantee them in this application. The monoclonal antibody was raised against the human recombinant AMH protein. The polyclonal was raised against an AMH peptide. Since we do not epitope map the monoclonal, we cannot say for certain that it will not bind to a similar region as the polyclonal. If you would like to test these in ELISA, then I can recommend our Innovator's Reward program. The theoretical and observed molecular weight for this protein is 59kDa. You can find more information on UniProt about this protein: UniProt P03971.

Secondary Antibodies

 

Isotype Controls

Additional MIS/AMH Products

Bioinformatics Tool for MIS/AMH Antibody (NBP1-70639)

Discover related pathways, diseases and genes to MIS/AMH Antibody (NBP1-70639). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MIS/AMH Antibody (NBP1-70639)

Discover more about diseases related to MIS/AMH Antibody (NBP1-70639).
 

Pathways for MIS/AMH Antibody (NBP1-70639)

View related products by pathway.

PTMs for MIS/AMH Antibody (NBP1-70639)

Learn more about PTMs related to MIS/AMH Antibody (NBP1-70639).

Blogs on MIS/AMH

There are no specific blogs for MIS/AMH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MIS/AMH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AMH
Entrez