New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Home » MDH1 » MDH1 Antibodies » MDH1 Antibody

MDH1 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: MDH1 Antibody [NBP1-89515] - Analysis in human cell line RT-4.
Western Blot: MDH1 Antibody [NBP1-89515] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: MDH1 Antibody [NBP1-89515] - Staining of human cell line U-251 MG shows localization to cytosol & centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MDH1 Antibody [NBP1-89515] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

MDH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVA
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MDH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MDH1 Recombinant Protein Antigen (NBP1-89515PEP)
Publications
Read Publication using NBP1-89515.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MDH1 Antibody

  • cytoplasmic
  • Cytosolic malate dehydrogenase
  • DEE88
  • Diiodophenylpyruvate reductase
  • EC 1.1.1.37
  • EC 1.1.1.96
  • HEL-S-32
  • malate dehydrogenase 1, NAD (soluble)
  • Malate dehydrogenase, cytoplasmic
  • MDH1
  • MDHA
  • MDH-s
  • MGC:1375
  • MOR2
  • soluble malate dehydrogenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ME1 Antibody
NBP1-32398
Western Blot: ME1 Antibody [NBP1-32398] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with ME1 antibody diluted at 1:1000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: ME1 Antibody [NBP1-32398] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Western Blot: ME1 Antibody [NBP1-32398] - Sample (30 ug of whole cell lysate) A: NIH-3T3 B: JC C: BCL-1 7. 5% SDS PAGE; antibody diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
ME3 Antibody
NBP1-85871
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human endometrium shows moderate granular cytoplasmic positivity.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human kidney shows granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human testis shows moderate to strong granular cytoplasmic positivity.
Species: Hu
Applications: IHC, IHC-P, WB
ME2 Antibody
NBP1-89559
Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining in human duodenum and liver tissues using anti-ME2 antibody. Corresponding ME2 RNA-seq data are presented for the same tissues.
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
MDH2 Antibody
NBP1-32259
Western Blot: MDH2 Antibody [NBP1-32259] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with MDH2 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: MDH2 Antibody [NBP1-32259] - A. 50 ug rat lung lysate/extract 10 % SDS-PAGEMDH2 antibody dilution: 1:5000
Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-32259] - Mouse heart. MDH2 antibody diluted at 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Glucose 6 phosphate isomerase(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Glucose 6 phosphate isomerase.
Immunohistochemistry-Paraffin: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - Staining of paraffin-embedded Adenocarcinoma of Human ovary tissue using anti-Glucose 6 phosphate isomerasemouse monoclonal antibody.
Immunohistochemistry-Paraffin: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - Staining of paraffin-embedded Carcinoma of Human prostate tissue using anti-Glucose 6 phosphate isomerasemouse monoclonal antibody.
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PGD Antibody
(OTI2A5)
NBP2-45880
Immunofluorescence: PGD Antibody (OTI2A5) [NBP2-45880] - Analysis of COS7 cells transiently transfected by pCMV6-ENTRY PGD.
Immunohistochemistry-Paraffin: PGD Antibody (OTI2A5) [NBP2-45880] - Human pancreas tissue within the normal limits using anti-PGD mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100 degrees C for 10min.
Immunohistochemistry-Paraffin: PGD Antibody (OTI2A5) [NBP2-45880] - Carcinoma of Human prostate tissue using anti-PGD mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100 degrees C for 10min.
Species: Hu, Mu, Rt
Applications: IF, IHC, IHC-P, WB
Glucose 6
Phosphate Dehydrogena ...
NB100-236
Immunoprecipitation: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Detection of mouse G6PD by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from NIH 3T3 cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-G6PD antibody NB100-236 (lot 2) used for IP at 6 ug per reaction. G6PD was also immunoprecipitated by a previous lot of this antibody (lot 1). For blotting immunoprecipitated G6PD, NB100-236 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Immunoblot analyses of protein expression for Nrf2 and antioxidant enzymes. Representative immunoblots of cytosolic extracts from the hearts of young and old mice under basal conditions and following EES. Protein blots were probed with anti-HO1, NQO1, GCLM, GCLC, Catalase, SOD1, SOD2, GSR, G6PD, GPX1 and GAPDH. Individual lanes indicate a single animal. Densitometry analysis of respective protein signals was performed using Image-J and expressed as relative intensity units calculated as mean values of young and old, *p<0.05. Individual lanes indicate each animal (n?=?6). #p<0.05-between basal and EES. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0045697), licensed under a CC-BY licence.
Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Detection of Human and Mouse G6PD by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-G6PD antibody NB100-236 used for WB at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(17 Publications)
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
Isocitrate
Dehydrogenase 1/IDH1 ...
NBP1-47804
Knockout Validated: Isocitrate Dehydrogenase 1/IDH1 Antibody (OTI2H9) [NBP1-47804] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and IDH1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:2,000 of Mouse Anti-Human IDH1 monoclonal Antibody (Catalog # NBP1-47804) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for IHD1 at approximately 38 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunocytochemistry/Immunofluorescence: Isocitrate Dehydrogenase 1/IDH1 Antibody (OTI2H9) [NBP1-47804] - Isocitrate Dehydrogenase 1/IDH1 Antibody (2H9) [NBP1-47804] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Isocitrate dehydrogenase.
Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody (2H9) [NBP1-47804] - Staining of paraffin-embedded breast tissue using anti-Isocitrate dehydrogenase mouse monoclonal antibody.
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(7 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Human ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Bovine ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
(3 Reviews)
(11 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
CRAT Antibody
NBP1-86615
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86615] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86615] - Staining of human tonsil shows low expression as expected.
Western Blot: CRAT Antibody [NBP1-86615] - Staining in human testis and tonsil tissues using anti-CRAT antibody. Corresponding CRAT RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P, WB
Adenosine
Deaminase/ADA Antibod
NBP1-87404
Immunohistochemistry-Paraffin: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
PGM1 Antibody
(3B8-H4)
H00005236-M01
Western Blot: PGM1 Antibody (3B8-H4) [H00005236-M01] - Analysis of PGM1 expression in transfected 293T cell line by PGM1 monoclonal antibody (M01), clone 3B8-H4.Lane 1: PGM1 transfected lysate(61.4 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: PGM1 Antibody (3B8-H4) [H00005236-M01] - Analysis of monoclonal antibody to PGM1 on HeLa cell. Antibody concentration 20 ug/ml.
Immunoprecipitation: PGM1 Antibody (3B8-H4) [H00005236-M01] - Analysis of PGM1 transfected lysate using anti-PGM1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PGM1 MaxPab rabbit polyclonal antibody.
(2 Publications)
Species: Bv, Hu
Applications: ELISA, ICC/IF, IP, KD, S-ELISA, WB
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Rat tissue extract (50ug) was separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody [GT1761] ) diluted at 1:1000.
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - A. 30 ug zebrafish heart lysate/extract 10 % SDS-PAGE Citrate synthetase antibody [GT1761] dilution: 1:1000
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Non-transfected (Negative) and transfected (Positive) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody diluted at 1:1000. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
UBL4A Antibody
(OTI1D4)
NBP2-03621
Western Blot: UBL4A Antibody (1D4) [NBP2-03621] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY UBL4A (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-UBL4A.
Immunohistochemistry-Paraffin: UBL4A Antibody (1D4) [NBP2-03621] - Staining of paraffin-embedded Human liver tissue using anti-UBL4A mouse monoclonal antibody.
Immunocytochemistry/Immunofluorescence: UBL4A Antibody (1D4) [NBP2-03621] Staining of COS7 cells transiently transfected by pCMV6-ENTRY UBL4A.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Lactate
Dehydrogenase A/LDHA ...
NBP1-48336
Flow Cytometry: Lactate Dehydrogenase A/LDHA Antibody [NBP1-48336]
Western Blot: Lactate Dehydrogenase A/LDHA Antibody [NBP1-48336] - Increased lactate level detected in the hippocampus of streptozotocin-injected mice fed an HFD (HFD + STZ).b LDHA and LDHB protein levels were measured by western blot assay. c LDHA protein levels were quantified by the ratio to B-actin in the hippocampus. f Cropped images of LDHA and LDHB in the cortex. g Quantified LDHA in the cortex by the ratio to B-actin. Values are expressed as means +/- SEMs (n = 5 for both groups). * p < 0.05. Image collected and cropped by Citeab from the following publication (Hyperpolarized [1-13C]lactate flux increased in the hippocampal region in diabetic mice. Mol Brain (2019) licensed under a CC-BY licence.
Flow Cytometry: Lactate Dehydrogenase A/LDHA Antibody [NBP1-48336] - An intracellular stain was performed on HeLa cells with Lactate Dehydrogenase A/LDHA Antibody NBP1-48336AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
(4 Reviews)
(26 Publications)
Species: Bv, Hu, Mu, Po
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin was detected in immersion fixed BG01V human embryonic stem cells differentiated to hepatocytes using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Cells were co-stained using Sheep Anti-Human CEBP alpha (Catalog # AF7094) and NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, Catalog # NL012). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Albumin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(5 Reviews)
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
GNPDA1 Antibody
NBP2-24653
Western Blot: GNPDA1 Antibody [NBP2-24653] - analysis of GNPDA1 in human spleen lysate in the 1) absence and 2) presence of immunizing peptide 3) mouse spleen and 4) rat spleen using GNPDA1 antibody at 1.0 ug/ml, 0.5 ug/ml and 0.5 ug/ml, respectively.
Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-24653] - Formalin-fixed paraffin-embedded human kidney tissue stained with GNPDA1 antibody at 10 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
GLYAT Antibody
NBP2-58917
Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human kidney shows high expression.
Species: Hu
Applications: IHC, IHC-P, WB
Lactate
Dehydrogenase B Antib
NBP1-55415
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - Sample Tissue: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12
Immunocytochemistry/Immunofluorescence: Lactate Dehydrogenase B Antibody [NBP1-55415] - Human lung adenocarcinoma cell line A549, 2.5.
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - Human pancreatic cancer cell line MiaPaca-2 and Panc-1, concentration 1 ug/ml.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for MDH1 Antibody (NBP1-89515)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MDH1 Antibody (NBP1-89515) (0)

There are no reviews for MDH1 Antibody (NBP1-89515). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MDH1 Antibody (NBP1-89515) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MDH1 Products

Bioinformatics Tool for MDH1 Antibody (NBP1-89515)

Discover related pathways, diseases and genes to MDH1 Antibody (NBP1-89515). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MDH1 Antibody (NBP1-89515)

Discover more about diseases related to MDH1 Antibody (NBP1-89515).
 

Pathways for MDH1 Antibody (NBP1-89515)

View related products by pathway.

PTMs for MDH1 Antibody (NBP1-89515)

Learn more about PTMs related to MDH1 Antibody (NBP1-89515).

Blogs on MDH1

There are no specific blogs for MDH1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MDH1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MDH1