MDH1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MDH1 Antibody [NBP1-89515] - Staining of human cell line U-251 MG shows localization to cytosol & centrosome. Antibody staining is shown in green.

Staining of human cerebral cortex shows moderate cytoplasmic positivity in glial cells.

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Staining of human placenta shows no cytoplasmic positivity in trophoblastic cells as expected.

Staining of human stomach shows strong cytoplasmic positivity in parietal cells.

Analysis in human cell line RT-4.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MDH1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVA
• Predicted Species: Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MDH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MDH1 Recombinant Protein Antigen (NBP1-89515PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MDH1 Antibody - BSA Free

• aromatic alpha-keto acid reductase
• cytoplasmic
• Cytosolic malate dehydrogenase
• DEE88
• Diiodophenylpyruvate reductase
• EC 1.1.1.37
• EC 1.1.1.96
• EIEE88
• epididymis secretory protein Li 32
• HEL-S-32
• KAR
• malate dehydrogenase 1, NAD (soluble)
• Malate dehydrogenase, cytoplasmic
• malate dehydrogenase, cytoplasmic; malate dehydrogenase, peroxisomal
• MDH1
• MDHA
• MDH-s
• MGC:1375
• MOR2
• soluble malate dehydrogenase

Background

Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MDH1 Antibody (NBP1-89515)(2)

Publications using NBP1-89515

• Igelmann S, Lessard F, Uchenunu O et al. A hydride transfer complex reprograms NAD metabolism and bypasses senescence Molecular cell 2021-09-16 [PMID: 34547241]
• Burr SP, Costa AS, Grice GL et al. Mitochondrial Protein Lipoylation and the 2-Oxoglutarate Dehydrogenase Complex Controls HIF1a Stability in Aerobic Conditions. Cell Metab. 2016-11-08 [PMID: 27923773] (Human)

Bioinformatics

• Gene Symbol: MDH1