New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

MDH1 Antibody

Images

 
Western Blot: MDH1 Antibody [NBP1-89515] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: MDH1 Antibody [NBP1-89515] - Staining of human cell line U-251 MG shows localization to cytosol & centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MDH1 Antibody [NBP1-89515] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MDH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVA
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MDH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MDH1 Recombinant Protein Antigen (NBP1-89515PEP)
Publications
Read Publication using NBP1-89515.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MDH1 Antibody

  • cytoplasmic
  • Cytosolic malate dehydrogenase
  • DEE88
  • Diiodophenylpyruvate reductase
  • EC 1.1.1.37
  • EC 1.1.1.96
  • HEL-S-32
  • malate dehydrogenase 1, NAD (soluble)
  • Malate dehydrogenase, cytoplasmic
  • MDH1
  • MDHA
  • MDH-s
  • MGC:1375
  • MOR2
  • soluble malate dehydrogenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-85871
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89559
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-32259
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45880
Species: Hu, Mu, Rt
Applications: IF, IHC, IHC-P, WB
NB100-236
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
NBP1-47804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
H00005236-M01
Species: Bv, Hu
Applications: ELISA, ICC/IF, IP, KD, S-ELISA, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-03621
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-48336
Species: Bv, Hu, Mu, Po
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-55415
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for MDH1 Antibody (NBP1-89515)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MDH1 Antibody (NBP1-89515) (0)

There are no reviews for MDH1 Antibody (NBP1-89515). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MDH1 Antibody (NBP1-89515) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MDH1 Products

Bioinformatics Tool for MDH1 Antibody (NBP1-89515)

Discover related pathways, diseases and genes to MDH1 Antibody (NBP1-89515). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MDH1 Antibody (NBP1-89515)

Discover more about diseases related to MDH1 Antibody (NBP1-89515).
 

Pathways for MDH1 Antibody (NBP1-89515)

View related products by pathway.

PTMs for MDH1 Antibody (NBP1-89515)

Learn more about PTMs related to MDH1 Antibody (NBP1-89515).

Blogs on MDH1

There are no specific blogs for MDH1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MDH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MDH1