MCPIP1/ZC3H12A Antibody

Images

 
Western Blot: MCPIP1/ZC3H12A Antibody [NBP1-83587] - Analysis in control (vector only transfected HEK293T lysate) and zC3H12A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: MCPIP1/ZC3H12A Antibody [NBP1-83587] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MCPIP1/ZC3H12A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AFPPREYWSEPYPLPPPTSVLQEPPVQSPGAGRSPWGRAGSLAKEQASVYTKLCGVFPPHLVEAVMGRFPQLLDPQQLAAEILSYKSQHPS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZC3H12A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100- 1:250
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
MCPIP1/ZC3H12A Protein (NBP1-83587PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MCPIP1/ZC3H12A Antibody

  • MCPIP1
  • ZC3H12A
  • zinc finger CCCH-type containing 12A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-2323
Species: Hu, Mu, Rt, Po, Ma, Mk, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NBP1-91249
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP1-83587
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MCPIP1/ZC3H12A Antibody (NBP1-83587) (0)

There are no publications for MCPIP1/ZC3H12A Antibody (NBP1-83587).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCPIP1/ZC3H12A Antibody (NBP1-83587) (0)

There are no reviews for MCPIP1/ZC3H12A Antibody (NBP1-83587). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MCPIP1/ZC3H12A Antibody (NBP1-83587) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MCPIP1/ZC3H12A Products

Bioinformatics Tool for MCPIP1/ZC3H12A Antibody (NBP1-83587)

Discover related pathways, diseases and genes to MCPIP1/ZC3H12A Antibody (NBP1-83587). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCPIP1/ZC3H12A Antibody (NBP1-83587)

Discover more about diseases related to MCPIP1/ZC3H12A Antibody (NBP1-83587).
 

Pathways for MCPIP1/ZC3H12A Antibody (NBP1-83587)

View related products by pathway.

PTMs for MCPIP1/ZC3H12A Antibody (NBP1-83587)

Learn more about PTMs related to MCPIP1/ZC3H12A Antibody (NBP1-83587).

Blogs on MCPIP1/ZC3H12A

There are no specific blogs for MCPIP1/ZC3H12A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCPIP1/ZC3H12A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZC3H12A
Entrez