ZC3H12D Antibody


Western Blot: ZC3H12D Antibody [NBP1-91249] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: ZC3H12D Antibody [NBP1-91249] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and vesicles.
Immunohistochemistry-Paraffin: ZC3H12D Antibody [NBP1-91249] - Staining of human duodenum shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

ZC3H12D Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLA
Specificity of human ZC3H12D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZC3H12D Protein (NBP1-91249PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ZC3H12D Antibody

  • C6orf95
  • FLJ46041
  • MCP-induced protein 4
  • p34
  • TFL
  • transformed follicular lymphoma
  • tumor suppressor TFL
  • zinc finger CCCH-type containing 12D


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZC3H12D Antibody (NBP1-91249) (0)

There are no publications for ZC3H12D Antibody (NBP1-91249).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZC3H12D Antibody (NBP1-91249) (0)

There are no reviews for ZC3H12D Antibody (NBP1-91249). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZC3H12D Antibody (NBP1-91249) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZC3H12D Products

ZC3H12D NBP1-91249

Bioinformatics Tool for ZC3H12D Antibody (NBP1-91249)

Discover related pathways, diseases and genes to ZC3H12D Antibody (NBP1-91249). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZC3H12D Antibody (NBP1-91249)

Discover more about diseases related to ZC3H12D Antibody (NBP1-91249).

Pathways for ZC3H12D Antibody (NBP1-91249)

View related products by pathway.

PTMs for ZC3H12D Antibody (NBP1-91249)

Learn more about PTMs related to ZC3H12D Antibody (NBP1-91249).

Blogs on ZC3H12D

There are no specific blogs for ZC3H12D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZC3H12D Antibody and receive a gift card or discount.


Gene Symbol ZC3H12D