ZC3H12D Antibody

Images

 
Western Blot: ZC3H12D Antibody [NBP1-91249] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: ZC3H12D Antibody [NBP1-91249] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and vesicles.
Immunohistochemistry-Paraffin: ZC3H12D Antibody [NBP1-91249] - Staining of human duodenum shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZC3H12D Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZC3H12D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZC3H12D Protein (NBP1-91249PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZC3H12D Antibody

  • C6orf95
  • FLJ46041
  • MCP-induced protein 4
  • p34
  • TFL
  • transformed follicular lymphoma
  • tumor suppressor TFL
  • zinc finger CCCH-type containing 12D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-85538
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
H00000902-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-2204
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PLA
NBP1-91249
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZC3H12D Antibody (NBP1-91249) (0)

There are no publications for ZC3H12D Antibody (NBP1-91249).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZC3H12D Antibody (NBP1-91249) (0)

There are no reviews for ZC3H12D Antibody (NBP1-91249). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZC3H12D Antibody (NBP1-91249) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZC3H12D Products

ZC3H12D NBP1-91249

Bioinformatics Tool for ZC3H12D Antibody (NBP1-91249)

Discover related pathways, diseases and genes to ZC3H12D Antibody (NBP1-91249). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZC3H12D Antibody (NBP1-91249)

Discover more about diseases related to ZC3H12D Antibody (NBP1-91249).
 

Pathways for ZC3H12D Antibody (NBP1-91249)

View related products by pathway.

PTMs for ZC3H12D Antibody (NBP1-91249)

Learn more about PTMs related to ZC3H12D Antibody (NBP1-91249).

Blogs on ZC3H12D

There are no specific blogs for ZC3H12D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZC3H12D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZC3H12D