MBP-1 Antibody - BSA Free

Immunohistochemistry-Paraffin: PRG2 Antibody [NBP1-88573] - Staining of human skeletal muscle shows no cytoplasmic positivity as expected.

Immunohistochemistry-Paraffin: PRG2 Antibody [NBP1-88573] - Staining of human placenta shows moderate to strong cytoplasmic positivity in extra villous trophoblast.

Analysis in control (vector only transfected HEK293T lysate) and pRG2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MBP-1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MBP-1 Antibody - BSA Free (NBP1-88573) is a polyclonal antibody validated for use in IHC and WB. Anti-MBP-1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRG2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MBP-1 Recombinant Protein Antigen (NBP1-88573PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MBP-1 Antibody - BSA Free

• BMPG
• BMPGeosinophil major basic protein
• bone marrow proteoglycan
• bone-marrow proteoglycan
• EMBP
• MBP1
• MBP-1
• MBPeosinophil granule major basic protein
• MGC14537
• natural killer cell activator
• PRG2
• proteoglycan 2 preproprotein
• Proteoglycan 2
• proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granulemajor basic protein)

Background

PRG2, also known as Bone marrow proteoglycan, is a 222 amino acid protein that is 25 kDa, found in high levels of the proform in placenta and pregnancy serum, may be involved in antiparasitic defense mechanisms as a cytotoxin and helminthotoxin, and in immune hypersensitivity reactions; is directly implicated in epithelial cell damage, exfoliation, and bronchospasm in allergic diseases; and the proform acts as a proteinase inhibitor, reducing the activity of PAPPA. Disease research is currently being studied in relation to PRG2 and malignant peripheral nerve sheath tumor, epithelioid malignant peripheral nerve sheath tumor, ocular cicatricial pemphigoid, cicatricial pemphigoid, giant papillary conjunctivitis, vernal keratoconjunctivitis, corneal ulcer, allergic rhinitis, eosinophilic gastroenteritis, papillary conjunctivitis, hypereosinophilic syndrome, eosinophilia, pulmonary eosinophilia,connective tissue disease, kimura disease, rhinitis, retinal detachment, keratoconjunctivitis, eosinophilic esophagitis, and familial eosinophilia. The protein has been shown to interact with CHD3, PAPPA, PRKCZ, AGT, CSF2, and other proteins in MAPK Signaling, Molecular Mechanisms of Cancer, PTEN Pathway, Transendothelial Migration of Leukocytes, UPA-UPAR Pathway, Selected targets of C/EBPbeta and Asthma pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MBP-1 Antibody (NBP1-88573)(1)

Publication using NBP1-88573

• Gormley M, Ona K, Kapidzic M et al. Preeclampsia: novel insights from global RNA profiling of trophoblast subpopulations. Am J Obstet Gynecol 2017-03-24 [PMID: 28347715]

Bioinformatics

• Gene Symbol: PRG2
• Entrez:
  • 5553(Human)
• Uniprot:
  • P13727(Human)