Lysyl Oxidase Homolog 2/LOXL2 Antibody (9F0W6)

Western Blot: Lysyl Oxidase Homolog 2/LOXL2 Antibody (9F0W6) [NBP3-16466] - Western blot analysis of extracts of various cell lines, using Lysyl Oxidase Homolog 2/LOXL2 Rabbit mAb (NBP3-16466) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

• Reactivity: Hu
• Applications: WB
• Clone: 9F0W6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Lysyl Oxidase Homolog 2/LOXL2 Antibody (9F0W6) Summary

• Description: Novus Biologicals Rabbit Lysyl Oxidase Homolog 2/LOXL2 Antibody (9F0W6) (NBP3-16466) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 675-774 of human Lysyl Oxidase Homolog 2/LOXL2 (Q9Y4K0). NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSPQ
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: LOXL2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Lysyl Oxidase Homolog 2/LOXL2 Antibody (9F0W6)

• EC 1.4.3
• EC 1.4.3.-
• LOL2
• LOR2
• LOXL2
• Lysyl Oxidase Homolog 2
• lysyl oxidase related 2
• lysyl oxidase-like 2
• Lysyl oxidase-like protein 2
• Lysyl oxidase-related protein 2
• Lysyl oxidase-related protein WS9-14
• WS9-14

Background

LOXL2 encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LOXL2