NDRG1 Antibody

Images

 
Orthogonal Strategies: Western Blot: NDRG1 Antibody [NBP1-86636] - Analysis in human cell lines HEK293 and MCF-7. Corresponding NDRG1 RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: NDRG1 Antibody [NBP1-86636] - Staining of human cell line U-2 OS shows localization to cytosol & microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Staining of human prostate shows strong membranous positivity in glandular cells.
Western Blot: NDRG1 Antibody [NBP1-86636] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Orthogonal Strategies: Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Analysis in human prostate and skeletal muscle tissues. Corresponding NDRG1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Staining of human colon shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Staining of human kidney shows moderate membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

NDRG1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: INVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLL
Specificity
Specificity of human, rat NDRG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDRG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100
Control Peptide
NDRG1 Protein (NBP1-86636PEP)
Publications
Read Publications using NBP1-86636.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23437357)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDRG1 Antibody

  • CAP43
  • CMT4D
  • Differentiation-related gene 1 protein
  • DRG1
  • DRG-1
  • DRG1HMSNL
  • GC4
  • HMSNL
  • NDR1
  • NDRG1
  • Nickel-specific induction protein Cap43
  • NMSL
  • N-myc downstream regulated 1
  • N-myc downstream-regulated gene 1 protein
  • protein NDRG1
  • protein regulated by oxygen-1
  • PROXY1
  • Reducing agents and tunicamycin-responsive protein
  • RIT42
  • RTP
  • RTPGC4
  • TARG1
  • TDD5
  • tunicamycin-responsive protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Ma, Pm, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, KO, LA
NBP2-74403
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
H00011329-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00057447-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA, KD
NBP1-97572
Species: Hu, Mu, Rt, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, In vivo, KD
NBP2-67561
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP2-88941
Species: Hu
Applications: IHC, IHC-P
NBP1-86046
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-417
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr, Dual ISH-IHC, KO
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-86636
Species: Hu, Rt, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDRG1 Antibody (NBP1-86636) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NDRG1 Products

Bioinformatics Tool for NDRG1 Antibody (NBP1-86636)

Discover related pathways, diseases and genes to NDRG1 Antibody (NBP1-86636). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDRG1 Antibody (NBP1-86636)

Discover more about diseases related to NDRG1 Antibody (NBP1-86636).
 

Pathways for NDRG1 Antibody (NBP1-86636)

View related products by pathway.

PTMs for NDRG1 Antibody (NBP1-86636)

Learn more about PTMs related to NDRG1 Antibody (NBP1-86636).
 

Research Areas for NDRG1 Antibody (NBP1-86636)

Find related products by research area.

Blogs on NDRG1.

Suppressing breast cancer metastasis: The role of hypoxia-induced RhoB expression and activation
By Jamshed Arslan, Pharm. D., PhD. The Ras homologous (Rho) GTPase family of signaling molecules has over 20 members, which typically cycle between active (GTP-bound) and inactive (GDP-bound) states. These small GTPa...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDRG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDRG1