LOXL4 Antibody (4H7)

Images

 
Sandwich ELISA: LOXL4 Antibody (4H7) [H00084171-M01] - Detection limit for recombinant GST tagged LOXL4 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
4H7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LOXL4 Antibody (4H7) Summary

Immunogen
LOXL4 (NP_115587, 657 a.a. ~ 755 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ACANFGEQGVTVGCWDTYRHDIDCQWVDITDVGPGNYIFQVIVNPHYEVAESDFSNNMLQCRCKYDGHRVWLHNCHTGNSYPANAELSLEQEQRLRNNL
Specificity
LOXL4 - lysyl oxidase-like 4
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LOXL4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Reviewed Applications
Read 2 Reviews rated 3
using
H00084171-M01 in the following applications:

Publications
Read Publications using
H00084171-M01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LOXL4 Antibody (4H7)

  • EC 1.4.3
  • EC 1.4.3.-
  • FLJ21889
  • LOX L4
  • LOXC
  • LOXClysyl oxidase related C
  • LOXL4
  • lysyl oxidase homolog 4
  • lysyl oxidase-like 4
  • Lysyl oxidase-like protein 4
  • Lysyl oxidase-related protein C

Background

This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2527
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NBP2-75964
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004016-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
NBP1-32954
Species: Hu, Mu, Fe
Applications: WB, ICC/IF, IHC, IHC-P, KO
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, Gp, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NB400-104
Species: Hu, Mu, Rt, Po, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, KD, KO
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
7954-GM/CF
Species: Hu
NBP2-75442
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-88941
Species: Hu
Applications: IHC, IHC-P

Publications for LOXL4 Antibody (H00084171-M01)(3)

Reviews for LOXL4 Antibody (H00084171-M01) (2) 32

Average Rating: 3
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.

Reviews using H00084171-M01:
Filter by Applications
WB
(2)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
  3
reviewed by:
Carmen Wong
WB Human 08/02/2010
View

Summary

ApplicationWestern Blot
Sample TestedCancer Cell lysate
SpeciesHuman
  3
reviewed by:
Anonymous
WB Human 06/14/2010
View

Summary

ApplicationWestern Blot
Sample TestedMDA231, Sample Amount: 100 ug
SpeciesHuman
Lot7186-447 00AdE
Commentsexpected band is very faint and a high concentration is required (1:100) for western blots. 1:100 dilution is required for detection. specific band is very faint.

Blocking

Blocking DetailsBlocking Buffer: 5% milk in TBST, Blocking Time: 1 hour, Blocking Temp: 22 degrees Celsius

Primary Anitbody

Dilution RatioDilution Ratio: 1:100, Incubation Dilution Buffer: 5% Milk in TBST, Incubation Time: overnight, Incubation Temp: 4 C

Secondary Antibody

Secondary DescriptionSecondary Ab: anti-mouse conjugated to HRP, Secondary Ab Dilution Ratio: 1:2500
Secondary Manufacturer Cat#sc-2371

Details

Detection NotesDetection Method: HRP, Exposure Time: 15 minutes, Specific Bands: ~85 kDa, Non-Specific Bands: many bands below 85 kDa

Comments

Commentsexpected band is very faint and a high concentration is required (1:100) for western blots. 1:100 dilution is required for detection. specific band is very faint.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LOXL4 Antibody (H00084171-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LOXL4 Products

Bioinformatics Tool for LOXL4 Antibody (H00084171-M01)

Discover related pathways, diseases and genes to LOXL4 Antibody (H00084171-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LOXL4 Antibody (H00084171-M01)

Discover more about diseases related to LOXL4 Antibody (H00084171-M01).
 

Pathways for LOXL4 Antibody (H00084171-M01)

View related products by pathway.

PTMs for LOXL4 Antibody (H00084171-M01)

Learn more about PTMs related to LOXL4 Antibody (H00084171-M01).
 

Research Areas for LOXL4 Antibody (H00084171-M01)

Find related products by research area.

Blogs on LOXL4

There are no specific blogs for LOXL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
2
2
0
1
0

 
Carmen Wong
08/02/2010
Application: WB
Species: Human

 
Anonymous
06/14/2010
Application: WB
Species: Human

Bioinformatics

Gene Symbol LOXL4
Entrez
OMIM
Uniprot