LLGL2 Antibody - BSA Free

Western Blot: LLGL2 Antibody [NBP3-03969] - Analysis of extracts of various cell lines, using LLGL2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.

• Reactivity: Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LLGL2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LLGL2 Antibody - BSA Free (NBP3-03969) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 938-1027 of mouse LLGL2 (NP_663413.2). DSTKAKKHNRPSNGNGTGLKMTSSGHVRNSKSQSDGDEKKPGPVMEHALLNDAWVLKEIQSTLEGDRRSYGNWHPHRVAVGCRLSNGEAE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LLGL2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 114 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LLGL2 Antibody - BSA Free

• HGLlethal giant larvae (Drosophila) homolog 2
• human giant larvae homolog
• lethal giant larvae homolog 2 (Drosophila)
• lethal(2) giant larvae protein homolog 2
• LGL2

Background

The lethal (2) giant larvae protein of Drosophila plays a role in asymmetric cell division, epithelial cell polarity, and cell migration. This human gene encodes a protein similar to lethal (2) giant larvae of Drosophila. In fly, the protein's ability to localize cell fate determinants is regulated by the atypical protein kinase C (aPKC). In human, this protein interacts with aPKC-containing complexes and is cortically localized in mitotic cells. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LLGL2