Pancreatic Lipase Antibody

Images

 
Immunohistochemistry-Paraffin: Pancreatic Lipase Antibody [NBP2-38958] - Staining of human pancreas shows high expression.
Immunohistochemistry-Paraffin: Pancreatic Lipase Antibody [NBP2-38958] - Staining of human pancreas shows high expression.
Immunohistochemistry-Paraffin: Pancreatic Lipase Antibody [NBP2-38958] - Staining of human tonsil shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Pancreatic Lipase Antibody [NBP2-38958] - Staining in human pancreas and tonsil tissues using anti-PNLIP antibody. Corresponding PNLIP RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Pancreatic Lipase Antibody [NBP2-38958] - Staining of human colon, kidney, liver and pancreas using Anti-PNLIP antibody NBP2-38958 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: Pancreatic Lipase Antibody [NBP2-38958] - Staining of human colon.
Immunohistochemistry-Paraffin: Pancreatic Lipase Antibody [NBP2-38958] - Staining of human kidney.
Immunohistochemistry-Paraffin: Pancreatic Lipase Antibody [NBP2-38958] - Staining of human liver.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pancreatic Lipase Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PTLPRVGASKIIVETNVGKQFNFCSPETVR
Specificity
Specificity of human Pancreatic Lipase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PNLIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pancreatic Lipase Antibody

  • EC 3.1.1.21
  • EC 3.1.1.3
  • pancreatic lipasepancreatic triacylglycerol lipase
  • PL
  • PTL
  • triacylglycerol acylhydrolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-86109
Species: Hu
Applications: WB, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP2-16019
Species: Hu
Applications: WB, IHC, IHC-P
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008546-B01P
Species: Hu
Applications: WB
NB100-2564
Species: Hu
Applications: WB
NBP2-59478
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00005555-P01
Species: Hu
MAB5018
Species: Hu
Applications: WB, IP
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
MAB5376
Species: Mu
Applications: WB, Flow, CyTOF-ready
NB110-60930
Species: Hu, Mu
Applications: WB

Publications for Pancreatic Lipase Antibody (NBP2-38958) (0)

There are no publications for Pancreatic Lipase Antibody (NBP2-38958).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pancreatic Lipase Antibody (NBP2-38958) (0)

There are no reviews for Pancreatic Lipase Antibody (NBP2-38958). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Pancreatic Lipase Antibody (NBP2-38958) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Pancreatic Lipase Products

Bioinformatics Tool for Pancreatic Lipase Antibody (NBP2-38958)

Discover related pathways, diseases and genes to Pancreatic Lipase Antibody (NBP2-38958). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pancreatic Lipase Antibody (NBP2-38958)

Discover more about diseases related to Pancreatic Lipase Antibody (NBP2-38958).
 

Pathways for Pancreatic Lipase Antibody (NBP2-38958)

View related products by pathway.

PTMs for Pancreatic Lipase Antibody (NBP2-38958)

Learn more about PTMs related to Pancreatic Lipase Antibody (NBP2-38958).

Blogs on Pancreatic Lipase

There are no specific blogs for Pancreatic Lipase, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pancreatic Lipase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PNLIP
Uniprot
COVID-19 update