Lgl1 Antibody (5G2)

Images

 
Western Blot: Lgl1 Antibody (5G2) [H00003996-M01] - Western Blot analysis of LLGL1 expression in Hela NE ( Cat # L013V3 ).
ELISA: Lgl1 Antibody (5G2) [H00003996-M01] - Detection limit for recombinant GST tagged LLGL1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5G2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Lgl1 Antibody (5G2) Summary

Immunogen
LLGL1 (NP_004131 911 a.a. - 1010 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDINWPRDATQASYRIRESPKLSQANGTPSILLAPQSLDGSPDPAHSMGPDTPEPPEAALSP
Specificity
LLGL1 - lethal giant larvae homolog 1 (Drosophila)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LLGL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Reviewed Applications
Read 1 Review rated 3
using
H00003996-M01 in the following applications:

Publications
Read Publications using
H00003996-M01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Lgl1 Antibody (5G2)

  • DLG4lethal giant larvae (Drosophila) homolog 1
  • HUGL
  • HUGL1
  • HUGL-1
  • Human homolog to the D-lgl gene protein
  • lethal giant larvae homolog 1 (Drosophila)
  • lethal(2) giant larvae protein homolog 1
  • LLGL

Background

This gene encodes a protein that is similar to a tumor suppressor in Drosophila. The protein is part of a cytoskeletal network and is associated with nonmuscle myosin II heavy chain and a kinase that specifically phosphorylates this protein at serine residues. The gene is located within the Smith-Magenis syndrome region on chromosome 17.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, ICC
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-21672
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88088
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-88790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005662-B01P
Species: Hu, Rt
Applications: WB, ICC/IF
NB300-653
Species: Hu, Mu, Rt, Ch, Fe, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-106
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-85014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85038
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-105
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, IP
NBP1-82243
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81829
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91928
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Lgl1 Antibody (H00003996-M01)(3)

Review for Lgl1 Antibody (H00003996-M01) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Mouse and Human.

Reviews using H00003996-M01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse and Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Lgl1 H00003996-M01
Enlarge
reviewed by:
Anonymous
WB Mouse and Human 11/06/2017
View

Summary

ApplicationWestern Blot
Sample Tested293T lysate,mouse liver
SpeciesMouse and Human
LotE4181-5G2

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lgl1 Antibody (H00003996-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Lgl1 Antibody (H00003996-M01)

Discover related pathways, diseases and genes to Lgl1 Antibody (H00003996-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lgl1 Antibody (H00003996-M01)

Discover more about diseases related to Lgl1 Antibody (H00003996-M01).
 

Pathways for Lgl1 Antibody (H00003996-M01)

View related products by pathway.

PTMs for Lgl1 Antibody (H00003996-M01)

Learn more about PTMs related to Lgl1 Antibody (H00003996-M01).

Blogs on Lgl1

There are no specific blogs for Lgl1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Anonymous
11/06/2017
Application: WB
Species: Mouse and Human

Bioinformatics

Gene Symbol LLGL1
Entrez
OMIM
Uniprot